Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L0HRW7

Protein Details
Accession A0A0L0HRW7    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MGRKSHPRFRKINYDRKRNENPERRDSBasic
NLS Segment(s)
Subcellular Location(s) nucl 24, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR023267  RCMT  
Gene Ontology GO:0003723  F:RNA binding  
GO:0001510  P:RNA methylation  
Amino Acid Sequences MGRKSHPRFRKINYDRKRNENPERRDSDYTKIEMKNERFEEYYKAQRILNDQEFEQFMTSLKVPLPSSFRITGSRRCEHQSAIDSRDLM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.8
3 0.82
4 0.85
5 0.83
6 0.84
7 0.84
8 0.81
9 0.8
10 0.79
11 0.76
12 0.72
13 0.65
14 0.61
15 0.55
16 0.49
17 0.46
18 0.41
19 0.38
20 0.39
21 0.39
22 0.4
23 0.38
24 0.38
25 0.33
26 0.32
27 0.34
28 0.3
29 0.35
30 0.29
31 0.28
32 0.27
33 0.27
34 0.29
35 0.31
36 0.31
37 0.25
38 0.23
39 0.24
40 0.24
41 0.23
42 0.19
43 0.12
44 0.09
45 0.09
46 0.1
47 0.09
48 0.09
49 0.12
50 0.12
51 0.15
52 0.19
53 0.2
54 0.24
55 0.25
56 0.27
57 0.3
58 0.34
59 0.4
60 0.44
61 0.47
62 0.46
63 0.49
64 0.5
65 0.46
66 0.49
67 0.48
68 0.46
69 0.45