Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0HNL2

Protein Details
Accession A0A0L0HNL2   
Localization Confidence High
Confidence Score 18.8
NoLS Segment(s)
PositionSequenceProtein Nature
134-160HTDTKPKFDKEKFKKANKDPPPQQETTHydrophilic
NLS Segment(s)
PositionSequence
68-72KERER
90-97RARRDKEH
Subcellular Location(s) nucl 22, cyto 3
Family & Domain DBs
Amino Acid Sequences MGHGTSKPVKASTPPPPQPPQDPRPGRTVLSTDPPQKPKQYVSDGPPGFLPYDDREEEEQERANRDRKERERLERERLEREQVDKDRLDRARRDKEHSERNREKDKNVMPPSRTPHLADSTTFIPLSPTPRHTHTDTKPKFDKEKFKKANKDPPPQQETTTIPHRDPLFLDESDEDFMAEILRETDFVALDRARGVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.58
3 0.63
4 0.66
5 0.7
6 0.71
7 0.68
8 0.68
9 0.68
10 0.63
11 0.63
12 0.61
13 0.53
14 0.47
15 0.44
16 0.37
17 0.38
18 0.42
19 0.44
20 0.48
21 0.53
22 0.54
23 0.55
24 0.55
25 0.52
26 0.53
27 0.52
28 0.51
29 0.5
30 0.56
31 0.51
32 0.48
33 0.43
34 0.37
35 0.29
36 0.24
37 0.21
38 0.13
39 0.19
40 0.19
41 0.21
42 0.21
43 0.24
44 0.26
45 0.25
46 0.27
47 0.23
48 0.27
49 0.28
50 0.33
51 0.34
52 0.38
53 0.46
54 0.48
55 0.56
56 0.59
57 0.66
58 0.7
59 0.71
60 0.75
61 0.72
62 0.7
63 0.66
64 0.61
65 0.56
66 0.48
67 0.45
68 0.43
69 0.38
70 0.39
71 0.33
72 0.32
73 0.34
74 0.36
75 0.37
76 0.36
77 0.42
78 0.48
79 0.5
80 0.55
81 0.56
82 0.59
83 0.65
84 0.66
85 0.69
86 0.66
87 0.69
88 0.73
89 0.66
90 0.6
91 0.58
92 0.55
93 0.54
94 0.54
95 0.53
96 0.45
97 0.49
98 0.53
99 0.48
100 0.45
101 0.36
102 0.32
103 0.31
104 0.3
105 0.25
106 0.23
107 0.2
108 0.2
109 0.18
110 0.14
111 0.12
112 0.12
113 0.17
114 0.17
115 0.19
116 0.21
117 0.25
118 0.3
119 0.32
120 0.4
121 0.42
122 0.51
123 0.51
124 0.56
125 0.58
126 0.6
127 0.64
128 0.63
129 0.67
130 0.65
131 0.73
132 0.74
133 0.77
134 0.82
135 0.83
136 0.86
137 0.85
138 0.87
139 0.84
140 0.84
141 0.82
142 0.74
143 0.67
144 0.61
145 0.54
146 0.49
147 0.49
148 0.42
149 0.35
150 0.38
151 0.37
152 0.34
153 0.32
154 0.3
155 0.26
156 0.23
157 0.25
158 0.22
159 0.22
160 0.22
161 0.2
162 0.16
163 0.12
164 0.12
165 0.1
166 0.08
167 0.07
168 0.06
169 0.06
170 0.07
171 0.07
172 0.08
173 0.08
174 0.09
175 0.13
176 0.12
177 0.12