Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0HIR6

Protein Details
Accession A0A0L0HIR6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
13-34TKSHTLCRRCGRRSFHNQKKTCHydrophilic
NLS Segment(s)
PositionSequence
52-91KGKRRKTTGTGRMRYLKTVARRFKNGFREGTAAKPKARAA
Subcellular Location(s) mito 10, cyto 9, mito_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR011331  Ribosomal_L37ae/L37e  
IPR001569  Ribosomal_L37e  
IPR018267  Ribosomal_L37e_CS  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0046872  F:metal ion binding  
GO:0019843  F:rRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01907  Ribosomal_L37e  
PROSITE View protein in PROSITE  
PS01077  RIBOSOMAL_L37E  
Amino Acid Sequences MTKGTQAFGKRHTKSHTLCRRCGRRSFHNQKKTCAQCGYPAAKIRHFEWSEKGKRRKTTGTGRMRYLKTVARRFKNGFREGTAAKPKARAAAPSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.65
3 0.67
4 0.64
5 0.69
6 0.73
7 0.77
8 0.75
9 0.77
10 0.74
11 0.73
12 0.78
13 0.81
14 0.81
15 0.82
16 0.79
17 0.76
18 0.78
19 0.73
20 0.67
21 0.59
22 0.49
23 0.44
24 0.48
25 0.45
26 0.39
27 0.41
28 0.37
29 0.37
30 0.38
31 0.33
32 0.35
33 0.33
34 0.3
35 0.29
36 0.36
37 0.42
38 0.5
39 0.57
40 0.55
41 0.59
42 0.63
43 0.63
44 0.62
45 0.64
46 0.65
47 0.67
48 0.65
49 0.66
50 0.68
51 0.63
52 0.57
53 0.5
54 0.45
55 0.44
56 0.49
57 0.53
58 0.51
59 0.58
60 0.61
61 0.66
62 0.7
63 0.66
64 0.6
65 0.54
66 0.53
67 0.48
68 0.52
69 0.53
70 0.47
71 0.44
72 0.44
73 0.42
74 0.43
75 0.43