Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6FMD0

Protein Details
Accession Q6FMD0   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MRESKVQEKKRAHNEKRSNELARHydrophilic
60-82PELEQFKKKQRSNRPTPNRQLLLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito 10, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR021346  Tma16  
IPR038356  Tma16_sf  
KEGG cgr:CAGL0K09042g  -  
Pfam View protein in Pfam  
PF11176  Tma16  
Amino Acid Sequences MRESKVQEKKRAHNEKRSNELARVKFIQDVIKSDSFKDKKNFSYEEAAVFIEQFINRDDPELEQFKKKQRSNRPTPNRQLLLEQKKKLEMEEFKKGFLCPDLADEQSVVFLRNWNGTFGAMSTFKMIRINNEGKQVVGGHNKFTGSENNEIEMA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.86
3 0.86
4 0.84
5 0.77
6 0.73
7 0.73
8 0.65
9 0.6
10 0.54
11 0.47
12 0.41
13 0.39
14 0.38
15 0.3
16 0.31
17 0.3
18 0.32
19 0.32
20 0.31
21 0.4
22 0.36
23 0.41
24 0.44
25 0.43
26 0.43
27 0.49
28 0.49
29 0.43
30 0.47
31 0.41
32 0.37
33 0.33
34 0.28
35 0.21
36 0.19
37 0.15
38 0.1
39 0.09
40 0.08
41 0.08
42 0.09
43 0.09
44 0.1
45 0.1
46 0.1
47 0.14
48 0.18
49 0.18
50 0.22
51 0.26
52 0.33
53 0.42
54 0.44
55 0.5
56 0.56
57 0.65
58 0.71
59 0.78
60 0.8
61 0.81
62 0.84
63 0.83
64 0.74
65 0.65
66 0.59
67 0.57
68 0.57
69 0.55
70 0.5
71 0.43
72 0.43
73 0.43
74 0.39
75 0.36
76 0.32
77 0.31
78 0.39
79 0.38
80 0.36
81 0.37
82 0.36
83 0.31
84 0.24
85 0.2
86 0.1
87 0.13
88 0.14
89 0.14
90 0.14
91 0.13
92 0.12
93 0.12
94 0.12
95 0.1
96 0.08
97 0.1
98 0.11
99 0.15
100 0.16
101 0.16
102 0.16
103 0.15
104 0.15
105 0.13
106 0.15
107 0.11
108 0.11
109 0.13
110 0.13
111 0.14
112 0.18
113 0.18
114 0.19
115 0.27
116 0.33
117 0.33
118 0.4
119 0.39
120 0.35
121 0.36
122 0.34
123 0.31
124 0.34
125 0.32
126 0.27
127 0.29
128 0.29
129 0.28
130 0.29
131 0.32
132 0.27
133 0.33
134 0.32