Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L0H766

Protein Details
Accession A0A0L0H766    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
24-47KAPAGEKKDKSKRKTVRRETYSTYHydrophilic
NLS Segment(s)
PositionSequence
8-40AAPKAEKKPAGKAPAGKAPAGEKKDKSKRKTVR
Subcellular Location(s) nucl 24.5, cyto_nucl 15
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR007125  Histone_H2A/H2B/H3  
IPR000558  Histone_H2B  
Gene Ontology GO:0000786  C:nucleosome  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0030527  F:structural constituent of chromatin  
Pfam View protein in Pfam  
PF00125  Histone  
PROSITE View protein in PROSITE  
PS00357  HISTONE_H2B  
Amino Acid Sequences MAPKEAAAAPKAEKKPAGKAPAGKAPAGEKKDKSKRKTVRRETYSTYIYKVLKQVHPDTGISNKAMSIMNSFVNDIFERIAGEASKLAAYNKRSTISSREIQTSVRLILPGELAKHAVSEGTKAVTKYQAAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.45
3 0.5
4 0.53
5 0.49
6 0.53
7 0.55
8 0.58
9 0.57
10 0.48
11 0.41
12 0.41
13 0.43
14 0.42
15 0.42
16 0.38
17 0.46
18 0.56
19 0.64
20 0.63
21 0.66
22 0.72
23 0.77
24 0.84
25 0.84
26 0.85
27 0.83
28 0.83
29 0.79
30 0.75
31 0.69
32 0.58
33 0.49
34 0.43
35 0.37
36 0.33
37 0.31
38 0.3
39 0.28
40 0.32
41 0.32
42 0.31
43 0.32
44 0.3
45 0.27
46 0.24
47 0.23
48 0.19
49 0.16
50 0.12
51 0.12
52 0.12
53 0.1
54 0.09
55 0.09
56 0.09
57 0.09
58 0.1
59 0.08
60 0.09
61 0.09
62 0.08
63 0.07
64 0.06
65 0.06
66 0.06
67 0.07
68 0.06
69 0.06
70 0.06
71 0.06
72 0.06
73 0.07
74 0.08
75 0.12
76 0.15
77 0.19
78 0.21
79 0.23
80 0.23
81 0.26
82 0.3
83 0.32
84 0.34
85 0.33
86 0.34
87 0.33
88 0.33
89 0.34
90 0.3
91 0.25
92 0.2
93 0.18
94 0.15
95 0.14
96 0.16
97 0.14
98 0.13
99 0.13
100 0.13
101 0.13
102 0.13
103 0.12
104 0.11
105 0.1
106 0.11
107 0.12
108 0.14
109 0.16
110 0.17
111 0.2
112 0.22