Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0HPG7

Protein Details
Accession A0A0L0HPG7    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
22-47APAKPATEKKEKSKRKTIRRETYSTYHydrophilic
NLS Segment(s)
PositionSequence
13-41TGGKKPAGKAPAKPATEKKEKSKRKTIRR
Subcellular Location(s) nucl 19.5, cyto_nucl 13, cyto 3.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR007125  Histone_H2A/H2B/H3  
IPR000558  Histone_H2B  
Gene Ontology GO:0000786  C:nucleosome  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0030527  F:structural constituent of chromatin  
Pfam View protein in Pfam  
PF00125  Histone  
PROSITE View protein in PROSITE  
PS00357  HISTONE_H2B  
Amino Acid Sequences MAPKEAPAAAAPTGGKKPAGKAPAKPATEKKEKSKRKTIRRETYSTYIYKVLKQVHPDTGISNKAMSIMNSFVNDIFERIAGEASKLAAYNKRSTISSREIQTSVRLILPGELAKHAVSEGTKAVTKYQSAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.21
3 0.19
4 0.23
5 0.28
6 0.35
7 0.35
8 0.39
9 0.47
10 0.54
11 0.55
12 0.56
13 0.58
14 0.58
15 0.64
16 0.64
17 0.65
18 0.67
19 0.74
20 0.77
21 0.8
22 0.81
23 0.82
24 0.88
25 0.89
26 0.89
27 0.86
28 0.84
29 0.79
30 0.75
31 0.69
32 0.58
33 0.49
34 0.43
35 0.37
36 0.33
37 0.31
38 0.3
39 0.28
40 0.32
41 0.32
42 0.31
43 0.32
44 0.3
45 0.27
46 0.24
47 0.23
48 0.19
49 0.16
50 0.12
51 0.12
52 0.12
53 0.1
54 0.09
55 0.09
56 0.09
57 0.09
58 0.1
59 0.08
60 0.09
61 0.09
62 0.08
63 0.07
64 0.06
65 0.06
66 0.06
67 0.07
68 0.06
69 0.06
70 0.06
71 0.06
72 0.06
73 0.07
74 0.08
75 0.12
76 0.15
77 0.19
78 0.21
79 0.23
80 0.23
81 0.26
82 0.3
83 0.32
84 0.34
85 0.33
86 0.34
87 0.33
88 0.33
89 0.34
90 0.3
91 0.25
92 0.2
93 0.18
94 0.15
95 0.14
96 0.16
97 0.14
98 0.13
99 0.13
100 0.13
101 0.13
102 0.13
103 0.12
104 0.11
105 0.1
106 0.11
107 0.12
108 0.14
109 0.16
110 0.17
111 0.21
112 0.23