Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0HRQ9

Protein Details
Accession A0A0L0HRQ9   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
31-56FIVQHFNKRARIKRIKRDISNSIQNSHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 7, extr 6, cyto_mito 6, mito 5, cyto_nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR045886  ThiF/MoeB/HesA  
IPR000594  ThiF_NAD_FAD-bd  
IPR035985  Ubiquitin-activating_enz  
Gene Ontology GO:0016020  C:membrane  
GO:0008641  F:ubiquitin-like modifier activating enzyme activity  
Pfam View protein in Pfam  
PF00899  ThiF  
CDD cd00755  YgdL_like  
Amino Acid Sequences MGLKAASLGDSIVNTLAVAIAASALTASSIFIVQHFNKRARIKRIKRDISNSIQNSINHLDEATDIARGVTSKKPLTTDEGLIREQLARNYAFLGEEGVAKIRSSFVIVVGLGGVGSHAAHMLLRSGVEHLRLIDFDQVTLSSLNRHAVATQADVGTPKSTCLKKHFLDIAPHAKIDACMELFNIAAAPELLSGNPDYVLDCIDNLNTKMDLIKYCVDSKIRIISSMGAGAKADPSRIQIADISETFEDPLARATRRGLKLKGVESGVTVVYSTEKPGAVKLLPLEEEKVQEADEYSALPDFRVRILPVLGTLPALFGNCMASYVITELAGWPTNPLAIKLREKTYMRLHRDLVNKEKDGFGASANIPFNVSDVGYIFEEIWRGRSALSGTFDKLQLIRWDVTKPASFQNVVCLTRHEAEKHEKILPHELEKHYSPEFIEFVQSRFAEERKINKWR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.07
4 0.05
5 0.05
6 0.04
7 0.04
8 0.03
9 0.03
10 0.03
11 0.03
12 0.03
13 0.04
14 0.04
15 0.04
16 0.05
17 0.06
18 0.07
19 0.14
20 0.17
21 0.26
22 0.32
23 0.36
24 0.44
25 0.53
26 0.61
27 0.65
28 0.73
29 0.75
30 0.8
31 0.87
32 0.89
33 0.88
34 0.88
35 0.85
36 0.83
37 0.83
38 0.74
39 0.67
40 0.62
41 0.53
42 0.5
43 0.45
44 0.37
45 0.26
46 0.24
47 0.2
48 0.16
49 0.18
50 0.13
51 0.1
52 0.09
53 0.09
54 0.09
55 0.09
56 0.12
57 0.14
58 0.2
59 0.23
60 0.25
61 0.28
62 0.3
63 0.36
64 0.37
65 0.37
66 0.37
67 0.38
68 0.36
69 0.34
70 0.32
71 0.28
72 0.26
73 0.23
74 0.2
75 0.17
76 0.17
77 0.18
78 0.17
79 0.15
80 0.13
81 0.13
82 0.09
83 0.1
84 0.1
85 0.11
86 0.11
87 0.1
88 0.11
89 0.1
90 0.09
91 0.1
92 0.1
93 0.09
94 0.1
95 0.1
96 0.1
97 0.09
98 0.09
99 0.06
100 0.06
101 0.05
102 0.03
103 0.03
104 0.03
105 0.03
106 0.03
107 0.03
108 0.04
109 0.05
110 0.05
111 0.05
112 0.06
113 0.08
114 0.09
115 0.1
116 0.1
117 0.1
118 0.11
119 0.11
120 0.12
121 0.14
122 0.13
123 0.12
124 0.12
125 0.11
126 0.12
127 0.12
128 0.11
129 0.08
130 0.1
131 0.11
132 0.11
133 0.11
134 0.1
135 0.12
136 0.13
137 0.12
138 0.13
139 0.12
140 0.11
141 0.12
142 0.12
143 0.11
144 0.1
145 0.1
146 0.15
147 0.17
148 0.21
149 0.26
150 0.33
151 0.33
152 0.39
153 0.44
154 0.42
155 0.45
156 0.47
157 0.49
158 0.42
159 0.41
160 0.35
161 0.29
162 0.25
163 0.21
164 0.16
165 0.09
166 0.08
167 0.08
168 0.08
169 0.08
170 0.07
171 0.06
172 0.04
173 0.04
174 0.04
175 0.04
176 0.04
177 0.04
178 0.04
179 0.05
180 0.05
181 0.05
182 0.05
183 0.05
184 0.05
185 0.05
186 0.06
187 0.05
188 0.05
189 0.05
190 0.06
191 0.07
192 0.07
193 0.08
194 0.07
195 0.07
196 0.08
197 0.09
198 0.1
199 0.11
200 0.13
201 0.13
202 0.15
203 0.17
204 0.17
205 0.16
206 0.17
207 0.21
208 0.19
209 0.17
210 0.16
211 0.15
212 0.14
213 0.16
214 0.15
215 0.09
216 0.09
217 0.08
218 0.1
219 0.09
220 0.09
221 0.07
222 0.08
223 0.1
224 0.1
225 0.11
226 0.1
227 0.11
228 0.12
229 0.12
230 0.12
231 0.1
232 0.1
233 0.1
234 0.09
235 0.08
236 0.06
237 0.09
238 0.1
239 0.1
240 0.11
241 0.14
242 0.21
243 0.26
244 0.31
245 0.3
246 0.33
247 0.37
248 0.38
249 0.39
250 0.32
251 0.27
252 0.22
253 0.22
254 0.16
255 0.12
256 0.1
257 0.06
258 0.07
259 0.07
260 0.08
261 0.08
262 0.08
263 0.09
264 0.09
265 0.11
266 0.1
267 0.11
268 0.11
269 0.11
270 0.12
271 0.13
272 0.14
273 0.13
274 0.14
275 0.14
276 0.13
277 0.11
278 0.1
279 0.1
280 0.09
281 0.08
282 0.07
283 0.07
284 0.08
285 0.08
286 0.07
287 0.08
288 0.08
289 0.09
290 0.11
291 0.11
292 0.11
293 0.11
294 0.12
295 0.11
296 0.12
297 0.1
298 0.09
299 0.08
300 0.07
301 0.07
302 0.07
303 0.06
304 0.05
305 0.06
306 0.06
307 0.07
308 0.06
309 0.06
310 0.06
311 0.07
312 0.07
313 0.06
314 0.06
315 0.06
316 0.08
317 0.08
318 0.08
319 0.08
320 0.08
321 0.1
322 0.1
323 0.11
324 0.14
325 0.19
326 0.26
327 0.29
328 0.32
329 0.38
330 0.4
331 0.44
332 0.49
333 0.54
334 0.55
335 0.56
336 0.55
337 0.54
338 0.6
339 0.61
340 0.6
341 0.58
342 0.52
343 0.49
344 0.47
345 0.41
346 0.35
347 0.29
348 0.2
349 0.18
350 0.16
351 0.2
352 0.2
353 0.19
354 0.17
355 0.17
356 0.17
357 0.13
358 0.12
359 0.07
360 0.07
361 0.09
362 0.09
363 0.1
364 0.09
365 0.09
366 0.11
367 0.11
368 0.13
369 0.12
370 0.12
371 0.11
372 0.14
373 0.15
374 0.18
375 0.22
376 0.22
377 0.24
378 0.26
379 0.26
380 0.26
381 0.24
382 0.24
383 0.24
384 0.26
385 0.25
386 0.25
387 0.26
388 0.27
389 0.32
390 0.3
391 0.29
392 0.3
393 0.33
394 0.32
395 0.3
396 0.37
397 0.39
398 0.37
399 0.35
400 0.33
401 0.33
402 0.36
403 0.4
404 0.33
405 0.33
406 0.41
407 0.46
408 0.47
409 0.48
410 0.47
411 0.47
412 0.55
413 0.52
414 0.5
415 0.52
416 0.51
417 0.51
418 0.5
419 0.51
420 0.43
421 0.4
422 0.34
423 0.29
424 0.27
425 0.22
426 0.27
427 0.24
428 0.24
429 0.29
430 0.27
431 0.27
432 0.29
433 0.3
434 0.3
435 0.35
436 0.42