Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6FS03

Protein Details
Accession Q6FS03    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
2-32AASLPHPKIVKKHTKKFKRHHSDRYHRVSENBasic
NLS Segment(s)
PositionSequence
9-25KIVKKHTKKFKRHHSDR
Subcellular Location(s) mito 14.5, mito_nucl 13, nucl 10.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0005576  C:extracellular region  
GO:0062040  C:fungal biofilm matrix  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG cgr:CAGL0H04521g  -  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAASLPHPKIVKKHTKKFKRHHSDRYHRVSENWRKQKGIDSVVRRRFRGNISEPTIGYGSNKKTKFMSPSGHKVVLVSNLKDLETLTMHTKSYAAEIAHNVSSKNRVTLLARAKALGVKVTNAKGRLALEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.8
3 0.88
4 0.91
5 0.92
6 0.92
7 0.92
8 0.92
9 0.92
10 0.93
11 0.92
12 0.91
13 0.86
14 0.76
15 0.71
16 0.71
17 0.7
18 0.7
19 0.7
20 0.64
21 0.58
22 0.58
23 0.61
24 0.57
25 0.53
26 0.5
27 0.49
28 0.56
29 0.64
30 0.67
31 0.6
32 0.55
33 0.51
34 0.47
35 0.46
36 0.42
37 0.41
38 0.42
39 0.43
40 0.41
41 0.39
42 0.36
43 0.28
44 0.23
45 0.19
46 0.18
47 0.23
48 0.24
49 0.23
50 0.25
51 0.27
52 0.31
53 0.31
54 0.34
55 0.32
56 0.4
57 0.43
58 0.42
59 0.39
60 0.35
61 0.31
62 0.31
63 0.28
64 0.21
65 0.19
66 0.18
67 0.18
68 0.18
69 0.17
70 0.11
71 0.09
72 0.1
73 0.12
74 0.13
75 0.13
76 0.13
77 0.13
78 0.12
79 0.13
80 0.14
81 0.11
82 0.12
83 0.13
84 0.16
85 0.17
86 0.18
87 0.17
88 0.15
89 0.2
90 0.19
91 0.19
92 0.17
93 0.18
94 0.2
95 0.28
96 0.35
97 0.36
98 0.36
99 0.34
100 0.34
101 0.34
102 0.32
103 0.29
104 0.21
105 0.19
106 0.24
107 0.29
108 0.33
109 0.32
110 0.32
111 0.31