Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0HVT6

Protein Details
Accession A0A0L0HVT6   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
84-106ELTGKSKQQCRDKIGKMKRKGDIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11, cyto_nucl 11, cyto 9, mito 3, pero 3
Family & Domain DBs
Amino Acid Sequences MDAVKQEPLHSTKEVDPLHIQRSRMKMEQNSEALTIESLDAEIIATFEKSVTKAQWHTDETQLLAALYRKNKANMDATWKKFNELTGKSKQQCRDKIGKMKRKGDI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.33
3 0.37
4 0.37
5 0.42
6 0.42
7 0.4
8 0.37
9 0.42
10 0.44
11 0.42
12 0.44
13 0.42
14 0.44
15 0.48
16 0.45
17 0.41
18 0.36
19 0.32
20 0.26
21 0.2
22 0.16
23 0.09
24 0.07
25 0.05
26 0.04
27 0.04
28 0.03
29 0.03
30 0.03
31 0.03
32 0.03
33 0.03
34 0.04
35 0.04
36 0.05
37 0.07
38 0.07
39 0.1
40 0.12
41 0.15
42 0.19
43 0.21
44 0.21
45 0.23
46 0.22
47 0.2
48 0.19
49 0.16
50 0.12
51 0.1
52 0.1
53 0.11
54 0.13
55 0.15
56 0.17
57 0.2
58 0.22
59 0.24
60 0.27
61 0.26
62 0.35
63 0.41
64 0.43
65 0.48
66 0.47
67 0.45
68 0.42
69 0.43
70 0.42
71 0.38
72 0.41
73 0.42
74 0.52
75 0.56
76 0.62
77 0.66
78 0.67
79 0.69
80 0.71
81 0.72
82 0.72
83 0.77
84 0.81
85 0.83
86 0.83