Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0H7Z8

Protein Details
Accession A0A0L0H7Z8   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
152-181HLQGDPIKRRRKAYRTKGRNKRSLREIMRDBasic
NLS Segment(s)
PositionSequence
158-174IKRRRKAYRTKGRNKRS
Subcellular Location(s) nucl 23, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR022776  TRM13/UPF0224_CHHC_Znf_dom  
Gene Ontology GO:0046872  F:metal ion binding  
PROSITE View protein in PROSITE  
PS51800  ZF_CHHC_U11_48K  
Amino Acid Sequences MSTDLPGSFMPASDSSVTLLGNTPLDSIRSELHSAHETLVDIVTSLGCSFDQIEEYTTRSKHLVSCPYVLSHRVPQKFLERHVERCKAKPSDRVSEHNTDLRRVEDAAQTGLGNPKRSYDQLGEPSTPLVGQRQSEDSTAIQQPLTRYLPKHLQGDPIKRRRKAYRTKGRNKRSLREIMRDVIDGYMADIANDDEKSQPNRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.15
3 0.15
4 0.15
5 0.12
6 0.13
7 0.11
8 0.11
9 0.11
10 0.11
11 0.1
12 0.12
13 0.12
14 0.12
15 0.13
16 0.15
17 0.17
18 0.16
19 0.2
20 0.21
21 0.21
22 0.2
23 0.19
24 0.16
25 0.15
26 0.15
27 0.1
28 0.08
29 0.07
30 0.06
31 0.06
32 0.05
33 0.05
34 0.05
35 0.05
36 0.06
37 0.06
38 0.08
39 0.08
40 0.1
41 0.1
42 0.13
43 0.16
44 0.16
45 0.17
46 0.16
47 0.17
48 0.19
49 0.24
50 0.3
51 0.29
52 0.32
53 0.31
54 0.32
55 0.32
56 0.3
57 0.27
58 0.26
59 0.31
60 0.3
61 0.31
62 0.31
63 0.39
64 0.4
65 0.41
66 0.44
67 0.39
68 0.45
69 0.51
70 0.57
71 0.5
72 0.52
73 0.56
74 0.52
75 0.53
76 0.53
77 0.5
78 0.51
79 0.53
80 0.54
81 0.52
82 0.5
83 0.48
84 0.44
85 0.4
86 0.31
87 0.28
88 0.24
89 0.19
90 0.15
91 0.15
92 0.12
93 0.12
94 0.11
95 0.11
96 0.1
97 0.1
98 0.15
99 0.15
100 0.15
101 0.15
102 0.16
103 0.17
104 0.18
105 0.21
106 0.19
107 0.23
108 0.27
109 0.3
110 0.29
111 0.27
112 0.26
113 0.23
114 0.2
115 0.15
116 0.11
117 0.1
118 0.1
119 0.12
120 0.15
121 0.16
122 0.17
123 0.18
124 0.16
125 0.18
126 0.19
127 0.18
128 0.15
129 0.15
130 0.16
131 0.19
132 0.22
133 0.21
134 0.2
135 0.25
136 0.33
137 0.36
138 0.4
139 0.36
140 0.42
141 0.47
142 0.56
143 0.62
144 0.64
145 0.68
146 0.68
147 0.75
148 0.75
149 0.78
150 0.79
151 0.79
152 0.81
153 0.83
154 0.9
155 0.93
156 0.93
157 0.93
158 0.9
159 0.87
160 0.85
161 0.84
162 0.8
163 0.78
164 0.72
165 0.68
166 0.62
167 0.54
168 0.45
169 0.35
170 0.28
171 0.19
172 0.15
173 0.13
174 0.1
175 0.09
176 0.09
177 0.1
178 0.11
179 0.12
180 0.12
181 0.12
182 0.18