Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0HFJ6

Protein Details
Accession A0A0L0HFJ6    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MPPKKAGKGAPAKKKKEAEQEABasic
NLS Segment(s)
PositionSequence
3-16PKKAGKGAPAKKKK
352-364GKKGGKGKKGKKK
Subcellular Location(s) nucl 18, mito_nucl 12.166, cyto_nucl 11.666, cyto_mito 5.166, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001611  Leu-rich_rpt  
IPR032675  LRR_dom_sf  
Pfam View protein in Pfam  
PF13516  LRR_6  
Amino Acid Sequences MPPKKAGKGAPAKKKKEAEQEAVNQIKAAQLKQLKAEYASKCKHFVTEPMPALVKRIDQELKRSDGYEDIDKIILNSMSLSPNDVYSITTTFHSYAALGGIYIWRASVETKGLEALADFLTSHPTVSVLHLMDCQITPQMARPLRSICHLSTGLKTLVLDHNPLGAEGVGMICAGIRENKASALVRLSFRYCEAGSAAAESLGTALNGCLQELQFDGNFLGDSGLIPLTKYLRRNSTLTILHIAANQISNSPLIPIPVNSSFPALNHQNQPTPLSTFCAMMGTENTTITLLDLRGNHIGSQGAEHVLEMLKSRKSLFTAKQAEPLLAMVSERMSEAMFDNIWDLNDAMAISGKKGGKGKKGKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.8
3 0.81
4 0.79
5 0.76
6 0.74
7 0.75
8 0.75
9 0.71
10 0.63
11 0.51
12 0.43
13 0.39
14 0.33
15 0.25
16 0.24
17 0.26
18 0.28
19 0.34
20 0.36
21 0.34
22 0.36
23 0.43
24 0.41
25 0.46
26 0.5
27 0.48
28 0.48
29 0.47
30 0.47
31 0.41
32 0.42
33 0.38
34 0.41
35 0.4
36 0.4
37 0.41
38 0.38
39 0.38
40 0.32
41 0.29
42 0.2
43 0.25
44 0.28
45 0.28
46 0.36
47 0.39
48 0.42
49 0.41
50 0.41
51 0.35
52 0.32
53 0.34
54 0.31
55 0.27
56 0.24
57 0.23
58 0.22
59 0.21
60 0.2
61 0.16
62 0.11
63 0.1
64 0.11
65 0.12
66 0.12
67 0.15
68 0.12
69 0.12
70 0.13
71 0.12
72 0.11
73 0.11
74 0.12
75 0.11
76 0.11
77 0.13
78 0.13
79 0.13
80 0.12
81 0.1
82 0.09
83 0.09
84 0.08
85 0.06
86 0.05
87 0.06
88 0.06
89 0.05
90 0.05
91 0.04
92 0.05
93 0.06
94 0.07
95 0.09
96 0.09
97 0.09
98 0.1
99 0.09
100 0.09
101 0.08
102 0.08
103 0.06
104 0.06
105 0.06
106 0.06
107 0.09
108 0.09
109 0.09
110 0.07
111 0.08
112 0.08
113 0.09
114 0.12
115 0.1
116 0.1
117 0.11
118 0.11
119 0.11
120 0.11
121 0.1
122 0.07
123 0.07
124 0.07
125 0.09
126 0.17
127 0.18
128 0.2
129 0.22
130 0.24
131 0.25
132 0.27
133 0.28
134 0.2
135 0.23
136 0.22
137 0.22
138 0.21
139 0.23
140 0.2
141 0.17
142 0.16
143 0.14
144 0.16
145 0.15
146 0.15
147 0.12
148 0.13
149 0.13
150 0.13
151 0.11
152 0.07
153 0.06
154 0.05
155 0.04
156 0.03
157 0.03
158 0.03
159 0.02
160 0.02
161 0.03
162 0.04
163 0.05
164 0.05
165 0.06
166 0.06
167 0.08
168 0.09
169 0.09
170 0.1
171 0.12
172 0.12
173 0.14
174 0.14
175 0.13
176 0.13
177 0.15
178 0.13
179 0.11
180 0.1
181 0.1
182 0.09
183 0.09
184 0.09
185 0.06
186 0.06
187 0.05
188 0.05
189 0.04
190 0.04
191 0.03
192 0.03
193 0.05
194 0.05
195 0.06
196 0.06
197 0.06
198 0.06
199 0.07
200 0.08
201 0.06
202 0.06
203 0.06
204 0.06
205 0.06
206 0.05
207 0.05
208 0.04
209 0.04
210 0.05
211 0.05
212 0.05
213 0.05
214 0.06
215 0.09
216 0.12
217 0.16
218 0.19
219 0.25
220 0.28
221 0.3
222 0.32
223 0.36
224 0.34
225 0.33
226 0.32
227 0.27
228 0.25
229 0.23
230 0.21
231 0.15
232 0.13
233 0.11
234 0.09
235 0.08
236 0.08
237 0.07
238 0.08
239 0.08
240 0.08
241 0.08
242 0.09
243 0.13
244 0.15
245 0.16
246 0.15
247 0.17
248 0.16
249 0.16
250 0.21
251 0.21
252 0.23
253 0.27
254 0.3
255 0.31
256 0.33
257 0.35
258 0.31
259 0.3
260 0.26
261 0.24
262 0.22
263 0.19
264 0.18
265 0.17
266 0.14
267 0.13
268 0.13
269 0.13
270 0.13
271 0.12
272 0.12
273 0.11
274 0.11
275 0.1
276 0.11
277 0.08
278 0.1
279 0.11
280 0.14
281 0.16
282 0.17
283 0.17
284 0.16
285 0.17
286 0.14
287 0.15
288 0.13
289 0.12
290 0.11
291 0.11
292 0.11
293 0.1
294 0.1
295 0.11
296 0.14
297 0.15
298 0.16
299 0.18
300 0.19
301 0.23
302 0.31
303 0.34
304 0.4
305 0.47
306 0.47
307 0.53
308 0.51
309 0.47
310 0.4
311 0.35
312 0.25
313 0.17
314 0.15
315 0.09
316 0.09
317 0.09
318 0.08
319 0.08
320 0.07
321 0.08
322 0.09
323 0.11
324 0.1
325 0.1
326 0.12
327 0.12
328 0.12
329 0.12
330 0.11
331 0.09
332 0.09
333 0.09
334 0.08
335 0.11
336 0.11
337 0.1
338 0.17
339 0.18
340 0.22
341 0.29
342 0.35
343 0.42
344 0.53