Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0HIP8

Protein Details
Accession A0A0L0HIP8   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
159-180REVEKRKRQSELKQQEQKRKEABasic
NLS Segment(s)
Subcellular Location(s) nucl 23, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039730  Jlp2/Ccd25  
IPR008532  NFACT_RNA-bd  
Pfam View protein in Pfam  
PF05670  NFACT-R_1  
Amino Acid Sequences MVFYFSSNVVSPAAEIYMGKDKYENEELIKYGWPEDVWFHVDKLSSAHVYLRLQKGQSWEDISEELLTDLAQLTKANSIEGNKKSNLTIIYTPWSNLKKTPGMETGQVTFHRNNMVKRIHVKERENAIVNRLNKTKVEKYPDLAEDKIQRDRETRNELREVEKRKRQSELKQQEQKRKEAELRSYSTVFKDERMKSNKELLEERRGLDINAIEEDFM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.11
4 0.19
5 0.19
6 0.19
7 0.21
8 0.21
9 0.28
10 0.33
11 0.31
12 0.25
13 0.27
14 0.28
15 0.27
16 0.29
17 0.22
18 0.19
19 0.18
20 0.15
21 0.13
22 0.14
23 0.16
24 0.17
25 0.17
26 0.17
27 0.17
28 0.18
29 0.17
30 0.17
31 0.17
32 0.14
33 0.14
34 0.15
35 0.17
36 0.19
37 0.26
38 0.29
39 0.28
40 0.28
41 0.3
42 0.33
43 0.32
44 0.32
45 0.28
46 0.24
47 0.22
48 0.22
49 0.2
50 0.15
51 0.13
52 0.1
53 0.07
54 0.07
55 0.05
56 0.05
57 0.04
58 0.05
59 0.05
60 0.05
61 0.08
62 0.08
63 0.09
64 0.1
65 0.12
66 0.19
67 0.23
68 0.26
69 0.24
70 0.25
71 0.25
72 0.26
73 0.24
74 0.2
75 0.18
76 0.16
77 0.18
78 0.17
79 0.17
80 0.2
81 0.21
82 0.19
83 0.19
84 0.21
85 0.22
86 0.23
87 0.26
88 0.24
89 0.24
90 0.25
91 0.24
92 0.22
93 0.2
94 0.21
95 0.2
96 0.16
97 0.16
98 0.19
99 0.2
100 0.2
101 0.24
102 0.25
103 0.26
104 0.32
105 0.36
106 0.39
107 0.43
108 0.45
109 0.44
110 0.47
111 0.48
112 0.46
113 0.41
114 0.37
115 0.36
116 0.35
117 0.33
118 0.3
119 0.28
120 0.26
121 0.32
122 0.34
123 0.34
124 0.41
125 0.38
126 0.39
127 0.42
128 0.44
129 0.42
130 0.35
131 0.33
132 0.32
133 0.33
134 0.37
135 0.34
136 0.32
137 0.32
138 0.35
139 0.39
140 0.43
141 0.44
142 0.43
143 0.46
144 0.46
145 0.49
146 0.52
147 0.53
148 0.52
149 0.56
150 0.58
151 0.56
152 0.62
153 0.64
154 0.66
155 0.7
156 0.71
157 0.74
158 0.76
159 0.81
160 0.84
161 0.82
162 0.78
163 0.71
164 0.68
165 0.64
166 0.62
167 0.63
168 0.6
169 0.6
170 0.58
171 0.56
172 0.5
173 0.45
174 0.41
175 0.33
176 0.3
177 0.34
178 0.35
179 0.42
180 0.47
181 0.5
182 0.5
183 0.58
184 0.57
185 0.52
186 0.55
187 0.51
188 0.55
189 0.52
190 0.49
191 0.46
192 0.44
193 0.39
194 0.35
195 0.31
196 0.23
197 0.23