Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q6FL32

Protein Details
Accession Q6FL32    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
101-132NDRSPIMRYRLSRKKKKRRAGKIKEKNISKEVBasic
NLS Segment(s)
PositionSequence
110-130RLSRKKKKRRAGKIKEKNISK
Subcellular Location(s) nucl 18.5, cyto_nucl 13, cyto 4.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR033010  Cdc20/Fizzy  
IPR015943  WD40/YVTN_repeat-like_dom_sf  
IPR001680  WD40_repeat  
IPR036322  WD40_repeat_dom_sf  
Gene Ontology GO:0005680  C:anaphase-promoting complex  
GO:0010997  F:anaphase-promoting complex binding  
GO:1990757  F:ubiquitin ligase activator activity  
GO:0030476  P:ascospore wall assembly  
GO:0044778  P:meiotic DNA integrity checkpoint signaling  
GO:1905786  P:positive regulation of anaphase-promoting complex-dependent catabolic process  
GO:1903024  P:positive regulation of ascospore-type prospore membrane formation  
GO:0007130  P:synaptonemal complex assembly  
KEGG cgr:CAGL0L06578g  -  
Pfam View protein in Pfam  
PF00400  WD40  
PROSITE View protein in PROSITE  
PS50082  WD_REPEATS_2  
Amino Acid Sequences MDRYIPLLTCKKAYKASNYKRNFDLNDVEIMDSSSSPERLSSPEFFTDLRYTGNYEHINYRGDNLSGQDMQLSSAESSNSTRSSVSTMTSSASSSSNLHANDRSPIMRYRLSRKKKKRRAGKIKEKNISKEVQKHKEYIARYLDFKSPERVLKFEYKTHIKSLKCNLTSDETKCLNTVPCEDFLSKINPLLQTLPPFEARYLFSNLLITDQNDGLAIFRDSKRPKSLIPYRVLDAPCLRNDFYSNLISWSRTTGNVIVGLGYSVYIWSERDGAIPVLNHSFLGLKHDLVTCLSFCPFNELFLVGTKQGRVMLFDQNRCIESYRSLGSSNRSEPLYEYQSLSCKGVSCFEWFLEDKICCDGANSAQIARLFIGEETGEVAYVEINSKISNCNVRDDYSKKGLDDLQILCLSKFQAQSQQVCGLSLNQYSKNLAVGGNDNSCTIWDISDIRSPRLVHTLPHNAAVKAVSYCPWSKSLLATGGGSKDRKIKFWHTLTGTLVKEIQTTGQITSLIWSVRYKQLVATFGFGDIDNPILLTVYSYPSLERLIHVRSSTPLRVLTAVPSSNLNAICLATNDETIRFYEIWGEDENTISEVQEAGIYNSKLIDFVEGISTHSEEYIR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.61
3 0.69
4 0.73
5 0.76
6 0.76
7 0.73
8 0.75
9 0.67
10 0.62
11 0.57
12 0.49
13 0.47
14 0.43
15 0.38
16 0.3
17 0.27
18 0.22
19 0.16
20 0.16
21 0.14
22 0.14
23 0.13
24 0.14
25 0.15
26 0.18
27 0.24
28 0.25
29 0.26
30 0.28
31 0.3
32 0.29
33 0.32
34 0.31
35 0.27
36 0.25
37 0.22
38 0.22
39 0.22
40 0.29
41 0.27
42 0.27
43 0.3
44 0.31
45 0.32
46 0.3
47 0.32
48 0.27
49 0.25
50 0.23
51 0.21
52 0.23
53 0.21
54 0.2
55 0.18
56 0.16
57 0.16
58 0.15
59 0.15
60 0.11
61 0.12
62 0.12
63 0.12
64 0.14
65 0.16
66 0.17
67 0.16
68 0.16
69 0.15
70 0.19
71 0.18
72 0.18
73 0.17
74 0.16
75 0.17
76 0.17
77 0.17
78 0.15
79 0.14
80 0.14
81 0.14
82 0.15
83 0.19
84 0.19
85 0.22
86 0.22
87 0.23
88 0.25
89 0.26
90 0.25
91 0.24
92 0.27
93 0.29
94 0.33
95 0.36
96 0.43
97 0.51
98 0.6
99 0.68
100 0.75
101 0.82
102 0.87
103 0.92
104 0.93
105 0.94
106 0.95
107 0.95
108 0.95
109 0.95
110 0.94
111 0.93
112 0.89
113 0.84
114 0.78
115 0.73
116 0.69
117 0.67
118 0.67
119 0.68
120 0.64
121 0.6
122 0.6
123 0.59
124 0.54
125 0.52
126 0.49
127 0.42
128 0.42
129 0.42
130 0.42
131 0.4
132 0.39
133 0.37
134 0.33
135 0.37
136 0.36
137 0.35
138 0.35
139 0.41
140 0.42
141 0.41
142 0.45
143 0.46
144 0.47
145 0.52
146 0.54
147 0.47
148 0.51
149 0.56
150 0.58
151 0.52
152 0.51
153 0.46
154 0.46
155 0.5
156 0.45
157 0.43
158 0.35
159 0.33
160 0.32
161 0.31
162 0.27
163 0.23
164 0.26
165 0.21
166 0.21
167 0.23
168 0.23
169 0.22
170 0.22
171 0.24
172 0.19
173 0.19
174 0.2
175 0.17
176 0.18
177 0.2
178 0.2
179 0.2
180 0.21
181 0.22
182 0.21
183 0.21
184 0.2
185 0.19
186 0.19
187 0.19
188 0.21
189 0.2
190 0.18
191 0.18
192 0.18
193 0.18
194 0.17
195 0.14
196 0.11
197 0.1
198 0.1
199 0.09
200 0.09
201 0.07
202 0.08
203 0.08
204 0.1
205 0.11
206 0.19
207 0.22
208 0.27
209 0.31
210 0.32
211 0.34
212 0.4
213 0.48
214 0.48
215 0.51
216 0.49
217 0.45
218 0.49
219 0.48
220 0.4
221 0.35
222 0.3
223 0.27
224 0.27
225 0.26
226 0.2
227 0.22
228 0.21
229 0.2
230 0.18
231 0.16
232 0.16
233 0.16
234 0.16
235 0.15
236 0.16
237 0.14
238 0.13
239 0.14
240 0.12
241 0.13
242 0.13
243 0.12
244 0.09
245 0.08
246 0.08
247 0.06
248 0.05
249 0.04
250 0.03
251 0.03
252 0.03
253 0.04
254 0.04
255 0.06
256 0.06
257 0.06
258 0.08
259 0.08
260 0.09
261 0.09
262 0.09
263 0.09
264 0.09
265 0.08
266 0.07
267 0.08
268 0.07
269 0.12
270 0.11
271 0.11
272 0.12
273 0.13
274 0.13
275 0.12
276 0.13
277 0.08
278 0.08
279 0.09
280 0.08
281 0.07
282 0.14
283 0.13
284 0.13
285 0.13
286 0.13
287 0.13
288 0.14
289 0.15
290 0.08
291 0.09
292 0.08
293 0.08
294 0.1
295 0.09
296 0.1
297 0.11
298 0.18
299 0.23
300 0.24
301 0.25
302 0.25
303 0.25
304 0.24
305 0.23
306 0.16
307 0.13
308 0.15
309 0.14
310 0.14
311 0.14
312 0.15
313 0.17
314 0.2
315 0.2
316 0.2
317 0.19
318 0.18
319 0.19
320 0.22
321 0.22
322 0.19
323 0.19
324 0.18
325 0.2
326 0.21
327 0.2
328 0.16
329 0.13
330 0.12
331 0.13
332 0.14
333 0.14
334 0.14
335 0.13
336 0.16
337 0.15
338 0.16
339 0.17
340 0.16
341 0.14
342 0.14
343 0.14
344 0.11
345 0.11
346 0.11
347 0.09
348 0.11
349 0.11
350 0.1
351 0.12
352 0.12
353 0.12
354 0.11
355 0.1
356 0.08
357 0.07
358 0.08
359 0.05
360 0.05
361 0.06
362 0.06
363 0.05
364 0.05
365 0.05
366 0.04
367 0.05
368 0.05
369 0.04
370 0.05
371 0.05
372 0.06
373 0.07
374 0.09
375 0.16
376 0.16
377 0.21
378 0.23
379 0.25
380 0.3
381 0.31
382 0.34
383 0.35
384 0.35
385 0.29
386 0.3
387 0.3
388 0.26
389 0.29
390 0.24
391 0.21
392 0.21
393 0.21
394 0.19
395 0.18
396 0.17
397 0.15
398 0.16
399 0.14
400 0.2
401 0.24
402 0.26
403 0.29
404 0.32
405 0.29
406 0.28
407 0.27
408 0.21
409 0.19
410 0.2
411 0.2
412 0.17
413 0.18
414 0.18
415 0.18
416 0.17
417 0.16
418 0.13
419 0.11
420 0.13
421 0.15
422 0.16
423 0.16
424 0.15
425 0.14
426 0.14
427 0.14
428 0.11
429 0.08
430 0.08
431 0.1
432 0.12
433 0.17
434 0.18
435 0.18
436 0.22
437 0.23
438 0.23
439 0.28
440 0.27
441 0.23
442 0.3
443 0.37
444 0.34
445 0.4
446 0.4
447 0.33
448 0.33
449 0.31
450 0.25
451 0.17
452 0.17
453 0.13
454 0.14
455 0.16
456 0.17
457 0.19
458 0.19
459 0.19
460 0.2
461 0.22
462 0.21
463 0.21
464 0.2
465 0.19
466 0.21
467 0.24
468 0.23
469 0.22
470 0.27
471 0.28
472 0.31
473 0.35
474 0.4
475 0.45
476 0.49
477 0.55
478 0.5
479 0.53
480 0.52
481 0.53
482 0.45
483 0.37
484 0.34
485 0.26
486 0.23
487 0.2
488 0.17
489 0.13
490 0.14
491 0.13
492 0.13
493 0.13
494 0.12
495 0.13
496 0.15
497 0.12
498 0.12
499 0.13
500 0.16
501 0.21
502 0.23
503 0.22
504 0.23
505 0.28
506 0.3
507 0.3
508 0.29
509 0.23
510 0.22
511 0.22
512 0.19
513 0.15
514 0.11
515 0.11
516 0.08
517 0.07
518 0.07
519 0.06
520 0.06
521 0.07
522 0.07
523 0.09
524 0.1
525 0.11
526 0.11
527 0.12
528 0.15
529 0.14
530 0.15
531 0.16
532 0.19
533 0.23
534 0.23
535 0.24
536 0.26
537 0.32
538 0.33
539 0.31
540 0.29
541 0.27
542 0.29
543 0.28
544 0.27
545 0.26
546 0.25
547 0.22
548 0.23
549 0.22
550 0.24
551 0.24
552 0.2
553 0.15
554 0.15
555 0.15
556 0.14
557 0.17
558 0.14
559 0.16
560 0.16
561 0.17
562 0.17
563 0.18
564 0.21
565 0.16
566 0.15
567 0.19
568 0.19
569 0.21
570 0.22
571 0.24
572 0.2
573 0.21
574 0.22
575 0.17
576 0.16
577 0.13
578 0.11
579 0.09
580 0.09
581 0.1
582 0.1
583 0.12
584 0.18
585 0.18
586 0.18
587 0.19
588 0.19
589 0.17
590 0.16
591 0.16
592 0.1
593 0.11
594 0.15
595 0.14
596 0.16
597 0.18
598 0.18
599 0.16