Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0HM89

Protein Details
Accession A0A0L0HM89    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
65-90ESTTSTKSKSDKKQKAKDLKPPPFTAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11, mito 10, cyto_nucl 9, cyto 5
Family & Domain DBs
Amino Acid Sequences MSFFKKLTKGKVKPGSDNASEHSDTTQLVQNQSAAKSGASQGIYSSSIPCPMMFEGARLSSVDTESTTSTKSKSDKKQKAKDLKPPPFTATIFVPTANRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.71
3 0.64
4 0.6
5 0.53
6 0.49
7 0.44
8 0.36
9 0.29
10 0.23
11 0.19
12 0.19
13 0.2
14 0.16
15 0.16
16 0.16
17 0.18
18 0.19
19 0.19
20 0.18
21 0.13
22 0.11
23 0.11
24 0.12
25 0.13
26 0.12
27 0.11
28 0.1
29 0.11
30 0.12
31 0.11
32 0.12
33 0.09
34 0.1
35 0.1
36 0.1
37 0.1
38 0.09
39 0.11
40 0.09
41 0.1
42 0.1
43 0.1
44 0.1
45 0.09
46 0.09
47 0.07
48 0.08
49 0.08
50 0.07
51 0.08
52 0.09
53 0.1
54 0.11
55 0.11
56 0.11
57 0.15
58 0.2
59 0.28
60 0.38
61 0.48
62 0.58
63 0.68
64 0.77
65 0.83
66 0.89
67 0.88
68 0.88
69 0.88
70 0.88
71 0.84
72 0.78
73 0.72
74 0.66
75 0.58
76 0.51
77 0.43
78 0.37
79 0.31
80 0.29