Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6FXD5

Protein Details
Accession Q6FXD5    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
74-98ARMTNKRTAKIIKRRKEKGRWYLTHHydrophilic
NLS Segment(s)
PositionSequence
65-93KRKRKFGFLARMTNKRTAKIIKRRKEKGR
Subcellular Location(s) mito 19, mito_nucl 12.333, cyto_mito 11.333, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG cgr:CAGL0B01793g  -  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MLSSSFGVLRPMNLTPGNGMIGKNSVSLIRNEISSGTSFSSILTLFPLQRRWKSRGNTYQPSTLKRKRKFGFLARMTNKRTAKIIKRRKEKGRWYLTH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.17
3 0.18
4 0.18
5 0.16
6 0.16
7 0.13
8 0.13
9 0.13
10 0.12
11 0.11
12 0.11
13 0.11
14 0.12
15 0.15
16 0.14
17 0.13
18 0.13
19 0.13
20 0.12
21 0.12
22 0.12
23 0.1
24 0.09
25 0.09
26 0.09
27 0.09
28 0.08
29 0.07
30 0.08
31 0.08
32 0.08
33 0.1
34 0.16
35 0.19
36 0.24
37 0.29
38 0.32
39 0.39
40 0.42
41 0.5
42 0.55
43 0.6
44 0.63
45 0.61
46 0.65
47 0.61
48 0.62
49 0.62
50 0.6
51 0.62
52 0.6
53 0.67
54 0.61
55 0.67
56 0.69
57 0.7
58 0.72
59 0.69
60 0.74
61 0.7
62 0.76
63 0.7
64 0.71
65 0.63
66 0.55
67 0.53
68 0.52
69 0.55
70 0.59
71 0.66
72 0.67
73 0.76
74 0.84
75 0.88
76 0.9
77 0.9
78 0.9