Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0H5Q6

Protein Details
Accession A0A0L0H5Q6    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
10-37RTVIAPKKPKPTRSTQQQSPPKPKTPESHydrophilic
NLS Segment(s)
PositionSequence
296-310GARRNKFRKGSGRVR
Subcellular Location(s) mito 23, nucl 2, cyto 2, cyto_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR040111  ODAD4  
IPR011990  TPR-like_helical_dom_sf  
IPR019734  TPR_repeat  
Pfam View protein in Pfam  
PF13432  TPR_16  
PROSITE View protein in PROSITE  
PS50005  TPR  
Amino Acid Sequences MPTRSPIPTRTVIAPKKPKPTRSTQQQSPPKPKTPESANPPSTSLIAQSQALFPALVAEAERLSRQGHYSAAISLYTRAIETRPTDPTALSLRSKCRILQGEYEIALQDAEQALKADPSFAKALAAKAEALFAAGNFEDALVWYHRGAYLRADVEEFRVGVLRCKQAIMVAIQGIDASQLKKERETSTKSSKGVGVYHPGVVGPARRSTTTRQVENVTQRPTTPYDTETFERNLLEELYEDRVFLRGLASDPVFMSAANGDVGALVREGERYMEGRLEYWKIRNPSGRPASAVISGARRNKFRKGSGRVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.68
3 0.74
4 0.79
5 0.8
6 0.76
7 0.79
8 0.79
9 0.8
10 0.82
11 0.8
12 0.83
13 0.85
14 0.88
15 0.89
16 0.86
17 0.84
18 0.8
19 0.75
20 0.72
21 0.71
22 0.7
23 0.68
24 0.71
25 0.66
26 0.62
27 0.6
28 0.53
29 0.45
30 0.36
31 0.29
32 0.21
33 0.18
34 0.17
35 0.16
36 0.16
37 0.15
38 0.15
39 0.13
40 0.1
41 0.09
42 0.08
43 0.08
44 0.07
45 0.07
46 0.07
47 0.08
48 0.09
49 0.08
50 0.09
51 0.11
52 0.12
53 0.13
54 0.13
55 0.14
56 0.14
57 0.14
58 0.14
59 0.13
60 0.12
61 0.12
62 0.11
63 0.1
64 0.09
65 0.09
66 0.09
67 0.12
68 0.15
69 0.17
70 0.2
71 0.22
72 0.22
73 0.21
74 0.24
75 0.24
76 0.25
77 0.25
78 0.26
79 0.28
80 0.32
81 0.33
82 0.31
83 0.34
84 0.36
85 0.35
86 0.37
87 0.36
88 0.35
89 0.34
90 0.34
91 0.27
92 0.21
93 0.17
94 0.11
95 0.08
96 0.06
97 0.05
98 0.05
99 0.06
100 0.06
101 0.07
102 0.07
103 0.08
104 0.07
105 0.1
106 0.11
107 0.1
108 0.11
109 0.11
110 0.12
111 0.11
112 0.12
113 0.1
114 0.09
115 0.09
116 0.08
117 0.07
118 0.06
119 0.05
120 0.05
121 0.05
122 0.05
123 0.04
124 0.04
125 0.04
126 0.04
127 0.06
128 0.05
129 0.06
130 0.06
131 0.06
132 0.08
133 0.09
134 0.09
135 0.09
136 0.11
137 0.11
138 0.12
139 0.12
140 0.11
141 0.12
142 0.12
143 0.1
144 0.07
145 0.09
146 0.09
147 0.12
148 0.15
149 0.16
150 0.15
151 0.16
152 0.15
153 0.14
154 0.15
155 0.13
156 0.1
157 0.08
158 0.08
159 0.08
160 0.08
161 0.07
162 0.06
163 0.06
164 0.05
165 0.07
166 0.11
167 0.11
168 0.13
169 0.17
170 0.21
171 0.26
172 0.32
173 0.37
174 0.43
175 0.48
176 0.47
177 0.45
178 0.43
179 0.39
180 0.35
181 0.3
182 0.27
183 0.22
184 0.22
185 0.2
186 0.17
187 0.16
188 0.14
189 0.15
190 0.11
191 0.13
192 0.15
193 0.16
194 0.19
195 0.23
196 0.33
197 0.37
198 0.37
199 0.37
200 0.39
201 0.44
202 0.5
203 0.51
204 0.44
205 0.39
206 0.37
207 0.37
208 0.36
209 0.35
210 0.28
211 0.24
212 0.23
213 0.27
214 0.28
215 0.28
216 0.27
217 0.24
218 0.22
219 0.2
220 0.19
221 0.14
222 0.13
223 0.1
224 0.1
225 0.14
226 0.14
227 0.14
228 0.13
229 0.14
230 0.13
231 0.13
232 0.11
233 0.07
234 0.09
235 0.12
236 0.12
237 0.12
238 0.12
239 0.14
240 0.13
241 0.12
242 0.11
243 0.08
244 0.08
245 0.07
246 0.07
247 0.05
248 0.06
249 0.06
250 0.06
251 0.05
252 0.05
253 0.05
254 0.06
255 0.06
256 0.07
257 0.09
258 0.1
259 0.11
260 0.14
261 0.14
262 0.15
263 0.18
264 0.22
265 0.24
266 0.28
267 0.34
268 0.36
269 0.42
270 0.49
271 0.49
272 0.55
273 0.59
274 0.56
275 0.52
276 0.5
277 0.47
278 0.41
279 0.39
280 0.31
281 0.29
282 0.33
283 0.38
284 0.41
285 0.46
286 0.48
287 0.56
288 0.61
289 0.65
290 0.69