Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L0H464

Protein Details
Accession A0A0L0H464    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
9-39ATKPTSSGGGKNKKKKWSKGKVKDKANNAVVHydrophilic
NLS Segment(s)
PositionSequence
7-33KKATKPTSSGGGKNKKKKWSKGKVKDK
Subcellular Location(s) nucl 19.5, cyto_nucl 13.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAKAADKKATKPTSSGGGKNKKKKWSKGKVKDKANNAVVFDKTTYDKLFKEVPTYKLVTPSVLVDRLRINGSLARIAIRELEAKGLIRLVDHHNSQLIYTRATKADDVEEKGAKKAEAADEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.51
3 0.51
4 0.55
5 0.63
6 0.71
7 0.75
8 0.76
9 0.8
10 0.83
11 0.84
12 0.85
13 0.87
14 0.88
15 0.92
16 0.91
17 0.92
18 0.89
19 0.85
20 0.83
21 0.78
22 0.69
23 0.6
24 0.54
25 0.43
26 0.37
27 0.3
28 0.22
29 0.18
30 0.17
31 0.16
32 0.16
33 0.15
34 0.17
35 0.21
36 0.19
37 0.25
38 0.27
39 0.28
40 0.29
41 0.31
42 0.29
43 0.29
44 0.29
45 0.22
46 0.18
47 0.17
48 0.15
49 0.15
50 0.15
51 0.12
52 0.13
53 0.14
54 0.14
55 0.13
56 0.12
57 0.11
58 0.12
59 0.12
60 0.12
61 0.11
62 0.1
63 0.1
64 0.1
65 0.09
66 0.1
67 0.09
68 0.1
69 0.1
70 0.1
71 0.1
72 0.11
73 0.09
74 0.08
75 0.11
76 0.14
77 0.18
78 0.18
79 0.19
80 0.2
81 0.21
82 0.21
83 0.24
84 0.2
85 0.19
86 0.2
87 0.22
88 0.22
89 0.24
90 0.24
91 0.2
92 0.26
93 0.28
94 0.3
95 0.32
96 0.35
97 0.34
98 0.36
99 0.36
100 0.29
101 0.25
102 0.25