Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q6FQ50

Protein Details
Accession Q6FQ50    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
72-97DYDKYKQANYKKINKRSKQSLKDFIIHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 13.5, nucl 12.5, cyto 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016848  RNase_P/MRP_Rpp29-subunit  
IPR036980  RNase_P/MRP_Rpp29_sf  
IPR023534  Rof/RNase_P-like  
IPR002730  Rpp29/RNP1  
Gene Ontology GO:0005655  C:nucleolar ribonuclease P complex  
GO:0000172  C:ribonuclease MRP complex  
GO:0000171  F:ribonuclease MRP activity  
GO:0004526  F:ribonuclease P activity  
GO:0033204  F:ribonuclease P RNA binding  
GO:0042134  F:rRNA primary transcript binding  
GO:0034965  P:intronic box C/D RNA processing  
GO:0000460  P:maturation of 5.8S rRNA  
GO:0000294  P:nuclear-transcribed mRNA catabolic process, RNase MRP-dependent  
GO:0001682  P:tRNA 5'-leader removal  
KEGG cgr:CAGL0I09152g  -  
Pfam View protein in Pfam  
PF01868  RNase_P-MRP_p29  
Amino Acid Sequences MDKAQDFINNNLLTKCFNDPKNEIDEGRLLDTLMLLPTDGGSTSRIKKIIEKRTRLHDTKVKNKVPNSEPIDYDKYKQANYKKINKRSKQSLKDFIIKSKLSVNKAKQIAHEKNITKKADLFKYLETNDPELYKDLPKYEKFRPLFSELWISYIQELLNISYPCQSTEFKANGMQILTKLSMADYNGAALRVTKSKNHNTVGIEGIVVWDAQKNFIMITSGSLVDEIKIIPKKGTLFDFEIPLNDEQALQYSILGDRFKYRSVDRAGRKFKTRRCDDLLFYVFDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.3
3 0.3
4 0.32
5 0.38
6 0.4
7 0.43
8 0.48
9 0.48
10 0.42
11 0.37
12 0.37
13 0.32
14 0.31
15 0.27
16 0.2
17 0.17
18 0.16
19 0.14
20 0.11
21 0.08
22 0.06
23 0.06
24 0.06
25 0.06
26 0.06
27 0.06
28 0.08
29 0.13
30 0.17
31 0.22
32 0.24
33 0.24
34 0.33
35 0.42
36 0.51
37 0.56
38 0.6
39 0.61
40 0.69
41 0.78
42 0.73
43 0.71
44 0.67
45 0.67
46 0.69
47 0.74
48 0.71
49 0.68
50 0.69
51 0.69
52 0.65
53 0.66
54 0.62
55 0.55
56 0.49
57 0.48
58 0.51
59 0.44
60 0.43
61 0.39
62 0.35
63 0.35
64 0.4
65 0.41
66 0.44
67 0.51
68 0.6
69 0.64
70 0.72
71 0.8
72 0.8
73 0.82
74 0.83
75 0.85
76 0.84
77 0.82
78 0.81
79 0.76
80 0.77
81 0.7
82 0.64
83 0.6
84 0.5
85 0.43
86 0.4
87 0.4
88 0.36
89 0.43
90 0.41
91 0.42
92 0.46
93 0.47
94 0.45
95 0.5
96 0.49
97 0.46
98 0.5
99 0.45
100 0.49
101 0.54
102 0.5
103 0.41
104 0.41
105 0.43
106 0.39
107 0.39
108 0.33
109 0.28
110 0.32
111 0.32
112 0.32
113 0.27
114 0.25
115 0.23
116 0.21
117 0.2
118 0.16
119 0.16
120 0.14
121 0.13
122 0.14
123 0.17
124 0.2
125 0.24
126 0.28
127 0.35
128 0.34
129 0.36
130 0.37
131 0.38
132 0.36
133 0.32
134 0.34
135 0.25
136 0.26
137 0.24
138 0.2
139 0.15
140 0.15
141 0.13
142 0.08
143 0.08
144 0.06
145 0.1
146 0.1
147 0.1
148 0.12
149 0.12
150 0.12
151 0.15
152 0.15
153 0.13
154 0.19
155 0.2
156 0.18
157 0.2
158 0.2
159 0.19
160 0.18
161 0.17
162 0.11
163 0.12
164 0.11
165 0.09
166 0.08
167 0.07
168 0.08
169 0.08
170 0.09
171 0.07
172 0.08
173 0.08
174 0.08
175 0.08
176 0.08
177 0.09
178 0.12
179 0.14
180 0.19
181 0.26
182 0.34
183 0.41
184 0.42
185 0.45
186 0.42
187 0.43
188 0.4
189 0.33
190 0.24
191 0.17
192 0.15
193 0.11
194 0.09
195 0.06
196 0.07
197 0.07
198 0.08
199 0.09
200 0.09
201 0.08
202 0.09
203 0.1
204 0.07
205 0.09
206 0.1
207 0.1
208 0.09
209 0.1
210 0.09
211 0.08
212 0.09
213 0.07
214 0.12
215 0.15
216 0.16
217 0.16
218 0.19
219 0.21
220 0.24
221 0.27
222 0.26
223 0.27
224 0.28
225 0.31
226 0.28
227 0.27
228 0.27
229 0.24
230 0.2
231 0.16
232 0.14
233 0.11
234 0.14
235 0.13
236 0.1
237 0.1
238 0.1
239 0.11
240 0.14
241 0.15
242 0.13
243 0.18
244 0.21
245 0.24
246 0.27
247 0.28
248 0.33
249 0.41
250 0.5
251 0.53
252 0.62
253 0.68
254 0.7
255 0.78
256 0.8
257 0.78
258 0.8
259 0.78
260 0.76
261 0.75
262 0.75
263 0.69
264 0.7
265 0.66