Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6FQ40

Protein Details
Accession Q6FQ40   
Localization Confidence Low
Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
75-103SEESLKARKKQIRQSNREKIKQRNFLNQLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
KEGG cgr:CAGL0I09372g  -  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MLRLLFTKRLLSSSVVLRNEAKQIKSSCLAGTPLSLNVKKTGKDPVALEDSEYPEWLWTVLDQTNTAAAAKAPVSEESLKARKKQIRQSNREKIKQRNFLNQL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.31
3 0.33
4 0.33
5 0.32
6 0.37
7 0.38
8 0.32
9 0.32
10 0.32
11 0.34
12 0.35
13 0.34
14 0.27
15 0.24
16 0.24
17 0.18
18 0.18
19 0.14
20 0.15
21 0.19
22 0.19
23 0.18
24 0.22
25 0.23
26 0.23
27 0.23
28 0.27
29 0.24
30 0.25
31 0.25
32 0.24
33 0.25
34 0.24
35 0.24
36 0.18
37 0.19
38 0.17
39 0.16
40 0.12
41 0.09
42 0.09
43 0.08
44 0.06
45 0.04
46 0.06
47 0.07
48 0.08
49 0.08
50 0.08
51 0.09
52 0.09
53 0.09
54 0.07
55 0.06
56 0.06
57 0.06
58 0.07
59 0.07
60 0.08
61 0.11
62 0.12
63 0.14
64 0.2
65 0.27
66 0.3
67 0.33
68 0.41
69 0.45
70 0.53
71 0.62
72 0.66
73 0.7
74 0.76
75 0.84
76 0.86
77 0.89
78 0.89
79 0.88
80 0.88
81 0.87
82 0.87
83 0.83