Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0HLQ7

Protein Details
Accession A0A0L0HLQ7   
Localization Confidence High
Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MTSKHGSRTAKKPPPKKQKLLSELLTHydrophilic
NLS Segment(s)
PositionSequence
8-18RTAKKPPPKKQ
Subcellular Location(s) nucl 19, mito 6
Family & Domain DBs
Amino Acid Sequences MTSKHGSRTAKKPPPKKQKLLSELLTVPRNAKQRALMETAQEESDYEEEEPLPGKDDSQSQGLSDLLGLFQAQFKKKNAQRTKKAESEHDAKLQMTVEQMKNYIAEREEERDDKIEGRKRKYEETWEHQATTMTAFTTDYERVLKGWAAIIDLLDTHHTGTFKARQEFHMDMDEQTKSHAVQAAHQFTIIQKQIHAAKKEAQELIKESYDTSHIRKAIQLLLNA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.9
3 0.9
4 0.89
5 0.89
6 0.87
7 0.85
8 0.77
9 0.72
10 0.66
11 0.62
12 0.55
13 0.45
14 0.39
15 0.37
16 0.4
17 0.36
18 0.34
19 0.35
20 0.36
21 0.4
22 0.44
23 0.39
24 0.35
25 0.36
26 0.34
27 0.28
28 0.24
29 0.19
30 0.15
31 0.14
32 0.12
33 0.1
34 0.1
35 0.09
36 0.1
37 0.11
38 0.09
39 0.12
40 0.1
41 0.1
42 0.11
43 0.14
44 0.16
45 0.18
46 0.18
47 0.15
48 0.16
49 0.15
50 0.14
51 0.11
52 0.09
53 0.05
54 0.05
55 0.05
56 0.04
57 0.07
58 0.12
59 0.14
60 0.18
61 0.21
62 0.3
63 0.34
64 0.45
65 0.53
66 0.59
67 0.66
68 0.71
69 0.76
70 0.73
71 0.72
72 0.66
73 0.61
74 0.56
75 0.49
76 0.43
77 0.37
78 0.31
79 0.29
80 0.24
81 0.19
82 0.15
83 0.16
84 0.14
85 0.14
86 0.14
87 0.13
88 0.14
89 0.14
90 0.14
91 0.09
92 0.1
93 0.11
94 0.14
95 0.16
96 0.16
97 0.16
98 0.16
99 0.16
100 0.17
101 0.22
102 0.26
103 0.3
104 0.34
105 0.39
106 0.4
107 0.45
108 0.45
109 0.49
110 0.49
111 0.5
112 0.54
113 0.5
114 0.48
115 0.43
116 0.4
117 0.31
118 0.24
119 0.18
120 0.09
121 0.07
122 0.07
123 0.07
124 0.09
125 0.09
126 0.09
127 0.1
128 0.1
129 0.1
130 0.11
131 0.11
132 0.08
133 0.1
134 0.09
135 0.08
136 0.08
137 0.08
138 0.07
139 0.07
140 0.07
141 0.06
142 0.06
143 0.06
144 0.08
145 0.08
146 0.09
147 0.13
148 0.19
149 0.25
150 0.29
151 0.3
152 0.31
153 0.37
154 0.38
155 0.36
156 0.34
157 0.29
158 0.25
159 0.26
160 0.25
161 0.18
162 0.18
163 0.17
164 0.13
165 0.14
166 0.17
167 0.14
168 0.2
169 0.29
170 0.32
171 0.31
172 0.31
173 0.29
174 0.26
175 0.33
176 0.3
177 0.22
178 0.18
179 0.23
180 0.31
181 0.38
182 0.4
183 0.36
184 0.39
185 0.44
186 0.49
187 0.49
188 0.43
189 0.39
190 0.4
191 0.42
192 0.37
193 0.32
194 0.27
195 0.24
196 0.27
197 0.27
198 0.28
199 0.29
200 0.29
201 0.3
202 0.32
203 0.34
204 0.37