Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0HT90

Protein Details
Accession A0A0L0HT90   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
192-213FDKQPSAHRDRRLGRSRRKPKRBasic
NLS Segment(s)
PositionSequence
199-213HRDRRLGRSRRKPKR
Subcellular Location(s) mito 21.5, mito_nucl 13.5, nucl 4.5
Family & Domain DBs
Amino Acid Sequences MLSRRSTCLALLTGRFCHLQPAISKRHLHSSTEEDGERIPVKRVYTRKKAGVMDARMAEAIFYSQHRPVPLGPAGNANVMGLVKDVWRKETGVPKKEMKLRSAESNSGERHDLRFVTSRIPQSIEKPTSLITPSPRFPLSELDPISHHSVVEYIYHTVPNILEPVMESYIGGRKKWRCRHAVHTSVEGQVQFDKQPSAHRDRRLGRSRRKPKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.28
3 0.25
4 0.27
5 0.24
6 0.24
7 0.27
8 0.33
9 0.38
10 0.43
11 0.48
12 0.44
13 0.54
14 0.52
15 0.48
16 0.45
17 0.44
18 0.43
19 0.43
20 0.41
21 0.31
22 0.29
23 0.3
24 0.28
25 0.22
26 0.21
27 0.2
28 0.22
29 0.29
30 0.38
31 0.44
32 0.51
33 0.57
34 0.6
35 0.64
36 0.63
37 0.64
38 0.63
39 0.57
40 0.52
41 0.45
42 0.4
43 0.33
44 0.31
45 0.22
46 0.13
47 0.1
48 0.07
49 0.07
50 0.1
51 0.12
52 0.14
53 0.14
54 0.16
55 0.16
56 0.2
57 0.21
58 0.2
59 0.18
60 0.2
61 0.2
62 0.19
63 0.18
64 0.13
65 0.1
66 0.09
67 0.08
68 0.05
69 0.05
70 0.06
71 0.09
72 0.09
73 0.11
74 0.12
75 0.13
76 0.17
77 0.26
78 0.34
79 0.36
80 0.41
81 0.42
82 0.47
83 0.52
84 0.51
85 0.43
86 0.4
87 0.37
88 0.39
89 0.39
90 0.36
91 0.32
92 0.34
93 0.32
94 0.28
95 0.27
96 0.2
97 0.18
98 0.18
99 0.15
100 0.13
101 0.16
102 0.16
103 0.18
104 0.21
105 0.22
106 0.22
107 0.24
108 0.23
109 0.23
110 0.31
111 0.29
112 0.25
113 0.24
114 0.23
115 0.22
116 0.22
117 0.21
118 0.18
119 0.2
120 0.22
121 0.24
122 0.24
123 0.23
124 0.23
125 0.26
126 0.25
127 0.28
128 0.27
129 0.25
130 0.25
131 0.27
132 0.3
133 0.25
134 0.2
135 0.13
136 0.13
137 0.12
138 0.13
139 0.12
140 0.1
141 0.11
142 0.11
143 0.11
144 0.11
145 0.11
146 0.1
147 0.1
148 0.07
149 0.07
150 0.07
151 0.1
152 0.1
153 0.1
154 0.09
155 0.09
156 0.16
157 0.18
158 0.18
159 0.23
160 0.3
161 0.41
162 0.51
163 0.58
164 0.6
165 0.65
166 0.75
167 0.78
168 0.79
169 0.72
170 0.68
171 0.62
172 0.56
173 0.51
174 0.41
175 0.32
176 0.25
177 0.23
178 0.18
179 0.18
180 0.18
181 0.17
182 0.25
183 0.31
184 0.39
185 0.44
186 0.5
187 0.58
188 0.64
189 0.74
190 0.76
191 0.79
192 0.8
193 0.84