Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0HB62

Protein Details
Accession A0A0L0HB62    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
6-36TSNPPPTSTTTKPKPKPKKHPNPLARKYGHHHydrophilic
NLS Segment(s)
PositionSequence
17-32KPKPKPKKHPNPLARK
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019310  Efg1  
Gene Ontology GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF10153  Efg1  
Amino Acid Sequences MPPKPTSNPPPTSTTTKPKPKPKKHPNPLARKYGHHLTPKTSESLSTLRKQVRDAQRLLKRDSLPATQQQELQRKVKALKIQIEDRMRSSREEKLWAKYKYIRFVEQKKCTRKLKALRTQLSTQDTKDPTALHEAETNLAYTIHYPADLKYISLFPKEGMQDPVTDARRKRIWEVVSGRVRNGGFGKGEVLRGRDVFGESSKEEEEDAVEESEKEEEGDDFFLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.62
3 0.67
4 0.72
5 0.77
6 0.83
7 0.86
8 0.91
9 0.92
10 0.93
11 0.94
12 0.96
13 0.95
14 0.95
15 0.92
16 0.91
17 0.83
18 0.76
19 0.72
20 0.69
21 0.66
22 0.64
23 0.58
24 0.53
25 0.56
26 0.53
27 0.49
28 0.41
29 0.34
30 0.29
31 0.34
32 0.34
33 0.31
34 0.36
35 0.38
36 0.39
37 0.41
38 0.46
39 0.49
40 0.51
41 0.52
42 0.55
43 0.58
44 0.61
45 0.62
46 0.59
47 0.5
48 0.47
49 0.47
50 0.4
51 0.37
52 0.4
53 0.41
54 0.35
55 0.38
56 0.41
57 0.46
58 0.47
59 0.46
60 0.4
61 0.39
62 0.4
63 0.4
64 0.38
65 0.35
66 0.38
67 0.39
68 0.41
69 0.45
70 0.48
71 0.45
72 0.43
73 0.41
74 0.35
75 0.33
76 0.32
77 0.3
78 0.28
79 0.34
80 0.34
81 0.37
82 0.45
83 0.43
84 0.44
85 0.45
86 0.47
87 0.47
88 0.47
89 0.46
90 0.44
91 0.53
92 0.58
93 0.61
94 0.66
95 0.65
96 0.7
97 0.69
98 0.66
99 0.66
100 0.65
101 0.66
102 0.67
103 0.69
104 0.67
105 0.66
106 0.64
107 0.61
108 0.56
109 0.47
110 0.38
111 0.35
112 0.31
113 0.27
114 0.26
115 0.21
116 0.17
117 0.22
118 0.21
119 0.15
120 0.16
121 0.15
122 0.15
123 0.15
124 0.14
125 0.09
126 0.09
127 0.08
128 0.07
129 0.08
130 0.07
131 0.07
132 0.07
133 0.07
134 0.11
135 0.11
136 0.1
137 0.1
138 0.13
139 0.14
140 0.15
141 0.15
142 0.12
143 0.16
144 0.18
145 0.19
146 0.2
147 0.19
148 0.18
149 0.2
150 0.27
151 0.27
152 0.3
153 0.29
154 0.32
155 0.36
156 0.38
157 0.4
158 0.4
159 0.38
160 0.42
161 0.47
162 0.49
163 0.54
164 0.52
165 0.49
166 0.46
167 0.44
168 0.38
169 0.34
170 0.28
171 0.2
172 0.19
173 0.22
174 0.19
175 0.23
176 0.22
177 0.22
178 0.22
179 0.21
180 0.22
181 0.2
182 0.2
183 0.18
184 0.18
185 0.2
186 0.18
187 0.21
188 0.21
189 0.2
190 0.18
191 0.17
192 0.16
193 0.13
194 0.14
195 0.12
196 0.12
197 0.11
198 0.12
199 0.13
200 0.12
201 0.1
202 0.09
203 0.09
204 0.1