Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0HAB3

Protein Details
Accession A0A0L0HAB3    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
76-99PSVHIPRLTRRDRRRLRQLEYELRHydrophilic
NLS Segment(s)
Subcellular Location(s) cysk 15, nucl 6.5, cyto_nucl 6, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MATFTPILVNAHHIEASTFGNDRNGDKPFMIPDDRRDSAVEFTSCKSSEDMEDMDYSTQRTKLQTQVDELGYKIAPSVHIPRLTRRDRRRLRQLEYELRMAWRPIGKDIANHIYESDVLAEVGIPPLAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.16
4 0.14
5 0.13
6 0.12
7 0.15
8 0.17
9 0.19
10 0.21
11 0.22
12 0.21
13 0.21
14 0.22
15 0.2
16 0.24
17 0.26
18 0.24
19 0.28
20 0.34
21 0.34
22 0.34
23 0.33
24 0.3
25 0.28
26 0.3
27 0.25
28 0.18
29 0.19
30 0.21
31 0.2
32 0.19
33 0.17
34 0.14
35 0.14
36 0.15
37 0.14
38 0.12
39 0.12
40 0.11
41 0.11
42 0.1
43 0.1
44 0.09
45 0.1
46 0.1
47 0.11
48 0.13
49 0.18
50 0.22
51 0.23
52 0.24
53 0.26
54 0.26
55 0.24
56 0.22
57 0.17
58 0.13
59 0.11
60 0.09
61 0.07
62 0.06
63 0.08
64 0.13
65 0.16
66 0.21
67 0.22
68 0.28
69 0.37
70 0.45
71 0.52
72 0.56
73 0.63
74 0.68
75 0.77
76 0.82
77 0.81
78 0.8
79 0.8
80 0.8
81 0.79
82 0.73
83 0.66
84 0.56
85 0.5
86 0.45
87 0.35
88 0.3
89 0.24
90 0.21
91 0.21
92 0.25
93 0.24
94 0.25
95 0.31
96 0.35
97 0.32
98 0.31
99 0.28
100 0.24
101 0.23
102 0.21
103 0.16
104 0.09
105 0.08
106 0.08
107 0.08
108 0.07
109 0.08