Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0HMB7

Protein Details
Accession A0A0L0HMB7    Localization Confidence High Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
45-72TSSRAPSRTKIRQLKSRPSKPHPPSRSSHydrophilic
196-216ITPVPKQYKPHRRRSFDPGDSHydrophilic
NLS Segment(s)
PositionSequence
52-75RTKIRQLKSRPSKPHPPSRSSPIR
Subcellular Location(s) nucl 23, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR031466  MIIP  
Gene Ontology GO:0030336  P:negative regulation of cell migration  
GO:0010972  P:negative regulation of G2/M transition of mitotic cell cycle  
Pfam View protein in Pfam  
PF15734  MIIP  
Amino Acid Sequences MTTDADLSRIRHLRSETRRLVRTLQDAKRDVGWEDELDVPITTATSSRAPSRTKIRQLKSRPSKPHPPSRSSPIRYKSTSPLARVKAKVEQRKQDVLQVLSQTDEFFDELQQYRSCYPSLFFGDSAPEPTPSIRKQEPPPDAPSPPDPRYYYTGVFKINDRLFPEPFPYPFLEAEGVESMLEDEPPVKVSIPHSVITPVPKQYKPHRRRSFDPGDSMDLSMVRSLKCSLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.6
3 0.62
4 0.65
5 0.69
6 0.66
7 0.67
8 0.63
9 0.64
10 0.63
11 0.6
12 0.6
13 0.58
14 0.57
15 0.54
16 0.49
17 0.4
18 0.34
19 0.3
20 0.21
21 0.21
22 0.21
23 0.19
24 0.18
25 0.17
26 0.13
27 0.11
28 0.1
29 0.08
30 0.06
31 0.08
32 0.1
33 0.12
34 0.16
35 0.21
36 0.24
37 0.29
38 0.39
39 0.45
40 0.53
41 0.61
42 0.65
43 0.7
44 0.76
45 0.82
46 0.83
47 0.84
48 0.83
49 0.81
50 0.84
51 0.83
52 0.85
53 0.81
54 0.76
55 0.72
56 0.72
57 0.74
58 0.68
59 0.69
60 0.65
61 0.64
62 0.6
63 0.58
64 0.55
65 0.55
66 0.53
67 0.49
68 0.5
69 0.49
70 0.52
71 0.5
72 0.46
73 0.44
74 0.48
75 0.53
76 0.52
77 0.55
78 0.54
79 0.58
80 0.56
81 0.54
82 0.49
83 0.41
84 0.36
85 0.29
86 0.24
87 0.19
88 0.18
89 0.13
90 0.09
91 0.09
92 0.06
93 0.06
94 0.06
95 0.07
96 0.08
97 0.11
98 0.11
99 0.11
100 0.12
101 0.13
102 0.13
103 0.11
104 0.11
105 0.12
106 0.15
107 0.15
108 0.14
109 0.13
110 0.15
111 0.15
112 0.17
113 0.14
114 0.11
115 0.1
116 0.11
117 0.15
118 0.14
119 0.2
120 0.2
121 0.25
122 0.3
123 0.39
124 0.44
125 0.44
126 0.48
127 0.47
128 0.45
129 0.42
130 0.43
131 0.42
132 0.38
133 0.39
134 0.35
135 0.34
136 0.37
137 0.38
138 0.34
139 0.3
140 0.32
141 0.29
142 0.29
143 0.27
144 0.31
145 0.29
146 0.29
147 0.29
148 0.29
149 0.28
150 0.28
151 0.31
152 0.25
153 0.25
154 0.24
155 0.23
156 0.22
157 0.2
158 0.21
159 0.18
160 0.15
161 0.17
162 0.14
163 0.13
164 0.1
165 0.1
166 0.09
167 0.08
168 0.08
169 0.06
170 0.05
171 0.06
172 0.07
173 0.08
174 0.07
175 0.09
176 0.11
177 0.19
178 0.22
179 0.22
180 0.21
181 0.23
182 0.25
183 0.28
184 0.3
185 0.3
186 0.33
187 0.36
188 0.42
189 0.51
190 0.61
191 0.65
192 0.72
193 0.76
194 0.77
195 0.8
196 0.83
197 0.83
198 0.78
199 0.77
200 0.7
201 0.65
202 0.58
203 0.53
204 0.43
205 0.33
206 0.27
207 0.22
208 0.2
209 0.14
210 0.15