Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L0HK44

Protein Details
Accession A0A0L0HK44    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
15-40LVWKRRFRLTDTQKYRHRKRLRAVDEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21.5, cyto_mito 13, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFRSTIATLGGLVWKRRFRLTDTQKYRHRKRLRAVDEVVDTLVESGVKLRALELARRAPKESEMSPLEKYWVASKRYRNGIKPIHWVPHWTKVPHGRRWTPSVVHHRRGPPGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.19
3 0.25
4 0.28
5 0.3
6 0.35
7 0.36
8 0.37
9 0.46
10 0.52
11 0.57
12 0.62
13 0.69
14 0.74
15 0.82
16 0.84
17 0.84
18 0.83
19 0.8
20 0.8
21 0.82
22 0.8
23 0.77
24 0.71
25 0.65
26 0.57
27 0.49
28 0.39
29 0.27
30 0.21
31 0.13
32 0.1
33 0.06
34 0.04
35 0.04
36 0.05
37 0.05
38 0.05
39 0.05
40 0.09
41 0.1
42 0.12
43 0.15
44 0.21
45 0.25
46 0.26
47 0.27
48 0.24
49 0.25
50 0.27
51 0.24
52 0.23
53 0.22
54 0.24
55 0.23
56 0.23
57 0.22
58 0.19
59 0.19
60 0.19
61 0.23
62 0.25
63 0.29
64 0.36
65 0.41
66 0.5
67 0.55
68 0.54
69 0.57
70 0.61
71 0.59
72 0.61
73 0.59
74 0.55
75 0.5
76 0.51
77 0.47
78 0.49
79 0.5
80 0.43
81 0.45
82 0.5
83 0.58
84 0.61
85 0.66
86 0.63
87 0.63
88 0.68
89 0.68
90 0.62
91 0.64
92 0.66
93 0.66
94 0.65
95 0.67
96 0.67