FuNGI

A0A0L0HK87

Protein Details

Accession

A0A0L0HK87

Localization Confidence

Medium

Confidence Score

13.6

NoLS Segment(s)

Position	Sequence	Protein Nature
477-509	SDQGRGPKKRATPSPRKTKQPKVGSGRGRRGSM	Basic

NLS Segment(s)

Position	Sequence
480-507	GRGPKKRATPSPRKTKQPKVGSGRGRRG

Subcellular Location(s)

nucl 14, mito 8, cyto 3

Family & Domain DBs

InterPro	View protein in InterPro IPR029005 LIM-bd/SEUSS
Pfam	View protein in Pfam PF01803 LIM_bind

Amino Acid Sequences

MFGPQIVQRPFIQAANPYTMHVPAHRLQHAQQQSPALHHPPTAPIQTQQPAAPHQPSPQFATPIPPQPTISNQGTSRARPSPSPIPSRPIHHPIPTQHPPTPQQPPQLHPHPQMIGQFRVPEVPEGRRVSLSQPSAVIAEGACTLRLLKFAKALDPGDDNRNTLSYWQRFTTDFFSHNGLFVLDYKIPGADPRSFKLTTAMLPRYLQTSHESGVMRLQMLLTDPTETQTSRDIIVKCPSTSFIYTYAGGIKVIHEGSLSATFSSAGRLDYFKLEISSQTEFVARTALEKDTIQVLSDELKVEGQSEAETASCRGQVQSQVDGLKNVKERVYAPESPLEGSNGCGITLRAMRCLEIAEVVYSMQDLIPWSVQKNAEGGSMGPKQALRECSRQILAQWRQRDGSFSSTNYNVPNYLVPDSDTLRTPVLPTGLKPLHHMVQLTPIAITPTSAASADYLGDYWMDSPAFAGRKRPPPIDTSDQGRGPKKRATPSPRKTKQPKVGSGRGRRGSMTASG

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.32
2	0.35
3	0.34
4	0.3
5	0.3
6	0.29
7	0.28
8	0.24
9	0.26
10	0.25
11	0.32
12	0.35
13	0.36
14	0.37
15	0.45
16	0.51
17	0.49
18	0.48
19	0.47
20	0.44
21	0.45
22	0.48
23	0.43
24	0.36
25	0.34
26	0.32
27	0.31
28	0.34
29	0.35
30	0.31
31	0.3
32	0.35
33	0.37
34	0.38
35	0.35
36	0.33
37	0.33
38	0.37
39	0.38
40	0.34
41	0.37
42	0.4
43	0.4
44	0.44
45	0.43
46	0.41
47	0.38
48	0.42
49	0.41
50	0.44
51	0.46
52	0.41
53	0.39
54	0.38
55	0.43
56	0.43
57	0.41
58	0.37
59	0.33
60	0.4
61	0.42
62	0.42
63	0.43
64	0.41
65	0.4
66	0.37
67	0.43
68	0.44
69	0.48
70	0.54
71	0.51
72	0.52
73	0.54
74	0.57
75	0.58
76	0.55
77	0.52
78	0.49
79	0.52
80	0.52
81	0.58
82	0.6
83	0.58
84	0.55
85	0.56
86	0.55
87	0.56
88	0.6
89	0.55
90	0.57
91	0.55
92	0.55
93	0.58
94	0.62
95	0.62
96	0.56
97	0.56
98	0.48
99	0.46
100	0.48
101	0.44
102	0.39
103	0.34
104	0.31
105	0.26
106	0.27
107	0.25
108	0.23
109	0.23
110	0.22
111	0.28
112	0.3
113	0.31
114	0.3
115	0.3
116	0.29
117	0.33
118	0.32
119	0.25
120	0.23
121	0.22
122	0.21
123	0.2
124	0.16
125	0.09
126	0.08
127	0.08
128	0.08
129	0.07
130	0.07
131	0.07
132	0.07
133	0.12
134	0.13
135	0.12
136	0.17
137	0.17
138	0.2
139	0.23
140	0.24
141	0.22
142	0.24
143	0.25
144	0.27
145	0.27
146	0.25
147	0.21
148	0.22
149	0.19
150	0.19
151	0.25
152	0.23
153	0.25
154	0.25
155	0.26
156	0.26
157	0.29
158	0.32
159	0.26
160	0.24
161	0.22
162	0.25
163	0.23
164	0.23
165	0.2
166	0.14
167	0.12
168	0.12
169	0.14
170	0.1
171	0.1
172	0.1
173	0.1
174	0.09
175	0.1
176	0.13
177	0.15
178	0.17
179	0.19
180	0.24
181	0.24
182	0.24
183	0.26
184	0.23
185	0.21
186	0.26
187	0.26
188	0.22
189	0.23
190	0.23
191	0.22
192	0.21
193	0.19
194	0.15
195	0.16
196	0.15
197	0.19
198	0.19
199	0.17
200	0.18
201	0.17
202	0.15
203	0.12
204	0.12
205	0.07
206	0.08
207	0.09
208	0.07
209	0.07
210	0.07
211	0.08
212	0.1
213	0.09
214	0.1
215	0.11
216	0.12
217	0.12
218	0.17
219	0.16
220	0.18
221	0.23
222	0.24
223	0.21
224	0.21
225	0.22
226	0.19
227	0.19
228	0.18
229	0.15
230	0.15
231	0.15
232	0.15
233	0.14
234	0.12
235	0.11
236	0.1
237	0.08
238	0.08
239	0.07
240	0.07
241	0.06
242	0.06
243	0.07
244	0.08
245	0.08
246	0.06
247	0.06
248	0.06
249	0.06
250	0.07
251	0.07
252	0.06
253	0.06
254	0.07
255	0.08
256	0.09
257	0.1
258	0.09
259	0.09
260	0.09
261	0.09
262	0.11
263	0.12
264	0.11
265	0.11
266	0.12
267	0.11
268	0.11
269	0.11
270	0.08
271	0.08
272	0.09
273	0.09
274	0.09
275	0.09
276	0.1
277	0.11
278	0.11
279	0.1
280	0.09
281	0.09
282	0.09
283	0.1
284	0.1
285	0.08
286	0.08
287	0.08
288	0.08
289	0.08
290	0.06
291	0.06
292	0.05
293	0.05
294	0.05
295	0.06
296	0.06
297	0.07
298	0.07
299	0.07
300	0.08
301	0.09
302	0.14
303	0.16
304	0.17
305	0.19
306	0.21
307	0.21
308	0.22
309	0.22
310	0.21
311	0.21
312	0.21
313	0.19
314	0.19
315	0.2
316	0.24
317	0.3
318	0.27
319	0.26
320	0.29
321	0.29
322	0.28
323	0.27
324	0.22
325	0.16
326	0.15
327	0.15
328	0.11
329	0.1
330	0.09
331	0.09
332	0.11
333	0.15
334	0.14
335	0.16
336	0.16
337	0.16
338	0.16
339	0.17
340	0.14
341	0.11
342	0.11
343	0.08
344	0.08
345	0.07
346	0.07
347	0.06
348	0.06
349	0.05
350	0.05
351	0.05
352	0.06
353	0.08
354	0.09
355	0.1
356	0.14
357	0.15
358	0.15
359	0.16
360	0.15
361	0.15
362	0.14
363	0.14
364	0.15
365	0.17
366	0.17
367	0.16
368	0.16
369	0.17
370	0.22
371	0.28
372	0.27
373	0.31
374	0.34
375	0.37
376	0.38
377	0.37
378	0.36
379	0.4
380	0.43
381	0.44
382	0.46
383	0.44
384	0.45
385	0.44
386	0.45
387	0.37
388	0.36
389	0.32
390	0.29
391	0.3
392	0.3
393	0.32
394	0.3
395	0.28
396	0.21
397	0.19
398	0.2
399	0.19
400	0.18
401	0.17
402	0.16
403	0.18
404	0.19
405	0.2
406	0.19
407	0.18
408	0.18
409	0.18
410	0.17
411	0.17
412	0.18
413	0.18
414	0.17
415	0.25
416	0.27
417	0.27
418	0.3
419	0.32
420	0.32
421	0.33
422	0.33
423	0.24
424	0.3
425	0.3
426	0.27
427	0.22
428	0.19
429	0.18
430	0.17
431	0.17
432	0.09
433	0.09
434	0.09
435	0.09
436	0.09
437	0.08
438	0.09
439	0.09
440	0.09
441	0.08
442	0.07
443	0.07
444	0.07
445	0.07
446	0.08
447	0.08
448	0.07
449	0.08
450	0.13
451	0.17
452	0.18
453	0.25
454	0.32
455	0.41
456	0.48
457	0.52
458	0.5
459	0.51
460	0.58
461	0.59
462	0.56
463	0.54
464	0.54
465	0.54
466	0.58
467	0.62
468	0.59
469	0.56
470	0.59
471	0.6
472	0.62
473	0.68
474	0.71
475	0.74
476	0.79
477	0.85
478	0.86
479	0.89
480	0.9
481	0.9
482	0.9
483	0.89
484	0.89
485	0.87
486	0.88
487	0.88
488	0.89
489	0.88
490	0.84
491	0.76
492	0.67
493	0.6

A0A0L0HK87

3D AlphaFold-predicted Structure Viewer