Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L0HGT3

Protein Details
Accession A0A0L0HGT3    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
77-99VTSKSAKKNAKRRAKKAGEKDQQHydrophilic
127-148PVDIEKKLKNLRKKLRQIEELQHydrophilic
NLS Segment(s)
PositionSequence
81-94SAKKNAKRRAKKAG
Subcellular Location(s) nucl 19, mito_nucl 12.333, cyto_nucl 11.833, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039333  PYM1  
IPR015362  WIBG_mago-bd  
IPR036348  WIBG_N_sf  
Gene Ontology GO:1903259  P:exon-exon junction complex disassembly  
Pfam View protein in Pfam  
PF09282  Mago-bind  
Amino Acid Sequences MSIPPVSGIRESQSGDRVIPATRRPDGSVRKERKVRPGYVPQEDVSRYTNAKVEATRVPEGYVPGIGVVQPSEASTVTSKSAKKNAKRRAKKAGEKDQQDGPAEKVTTTPDSKALSDTPAKTQATAPVDIEKKLKNLRKKLRQIEELQEKQAKGGNLIQEQRDKLSGKKDVEKEIAELEQSLKGFHV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.24
3 0.25
4 0.23
5 0.23
6 0.26
7 0.28
8 0.3
9 0.32
10 0.34
11 0.35
12 0.43
13 0.49
14 0.54
15 0.6
16 0.61
17 0.67
18 0.73
19 0.76
20 0.77
21 0.76
22 0.71
23 0.69
24 0.72
25 0.71
26 0.68
27 0.66
28 0.56
29 0.52
30 0.48
31 0.41
32 0.33
33 0.28
34 0.22
35 0.21
36 0.23
37 0.19
38 0.21
39 0.19
40 0.2
41 0.21
42 0.25
43 0.26
44 0.23
45 0.22
46 0.21
47 0.22
48 0.18
49 0.15
50 0.1
51 0.08
52 0.07
53 0.06
54 0.06
55 0.05
56 0.04
57 0.04
58 0.04
59 0.05
60 0.05
61 0.06
62 0.07
63 0.08
64 0.09
65 0.13
66 0.15
67 0.17
68 0.26
69 0.32
70 0.4
71 0.49
72 0.58
73 0.65
74 0.72
75 0.76
76 0.79
77 0.81
78 0.81
79 0.81
80 0.82
81 0.78
82 0.72
83 0.68
84 0.61
85 0.54
86 0.47
87 0.38
88 0.29
89 0.23
90 0.2
91 0.17
92 0.15
93 0.14
94 0.16
95 0.15
96 0.15
97 0.15
98 0.17
99 0.17
100 0.18
101 0.17
102 0.17
103 0.2
104 0.2
105 0.2
106 0.25
107 0.24
108 0.24
109 0.24
110 0.26
111 0.25
112 0.25
113 0.23
114 0.23
115 0.24
116 0.25
117 0.27
118 0.23
119 0.25
120 0.32
121 0.39
122 0.42
123 0.51
124 0.61
125 0.68
126 0.77
127 0.82
128 0.82
129 0.83
130 0.79
131 0.79
132 0.79
133 0.71
134 0.67
135 0.61
136 0.52
137 0.46
138 0.44
139 0.34
140 0.26
141 0.27
142 0.27
143 0.28
144 0.32
145 0.35
146 0.37
147 0.38
148 0.37
149 0.38
150 0.34
151 0.31
152 0.36
153 0.4
154 0.4
155 0.48
156 0.5
157 0.53
158 0.56
159 0.54
160 0.47
161 0.43
162 0.38
163 0.3
164 0.26
165 0.21
166 0.19
167 0.18