Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0HEK0

Protein Details
Accession A0A0L0HEK0    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
235-255PPSVHQGPDRSRRPDKRARIEBasic
NLS Segment(s)
PositionSequence
245-252SRRPDKRA
Subcellular Location(s) nucl 11, mito 9, cyto 4, plas 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
Amino Acid Sequences MPITAFKTMNNLPSIPPLPIAPPTTPYFTYQPSPELPQTDVPPTKVRDLRPGMRGVNLDVVVIDKYVIESRKGPRFLFWVGDDSGSVILSLLDADIGHKVHQGNMLHLINCESRFFKGSLQVALYPNTGKLERYADMLQAFEPEPNVSHYLWEPDGTRAGAWTQREPETKSMTWYIPPPHPTLRPAILPRQQPLQHALSAQPQQPPSYPPNQQPPNHFVGSRGPPPYPNERFRPPPSVHQGPDRSRRPDKRARIE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.28
3 0.26
4 0.22
5 0.22
6 0.25
7 0.27
8 0.21
9 0.24
10 0.26
11 0.3
12 0.3
13 0.32
14 0.31
15 0.31
16 0.34
17 0.32
18 0.32
19 0.31
20 0.35
21 0.34
22 0.33
23 0.32
24 0.32
25 0.33
26 0.37
27 0.36
28 0.34
29 0.37
30 0.37
31 0.42
32 0.43
33 0.43
34 0.44
35 0.49
36 0.52
37 0.51
38 0.54
39 0.47
40 0.45
41 0.44
42 0.36
43 0.33
44 0.27
45 0.22
46 0.16
47 0.16
48 0.12
49 0.11
50 0.1
51 0.05
52 0.06
53 0.1
54 0.11
55 0.12
56 0.16
57 0.23
58 0.3
59 0.34
60 0.33
61 0.32
62 0.35
63 0.35
64 0.33
65 0.28
66 0.24
67 0.21
68 0.21
69 0.19
70 0.15
71 0.14
72 0.1
73 0.09
74 0.05
75 0.04
76 0.04
77 0.04
78 0.03
79 0.03
80 0.03
81 0.03
82 0.04
83 0.05
84 0.05
85 0.08
86 0.08
87 0.09
88 0.14
89 0.14
90 0.14
91 0.2
92 0.21
93 0.19
94 0.19
95 0.2
96 0.16
97 0.17
98 0.17
99 0.11
100 0.11
101 0.13
102 0.13
103 0.13
104 0.16
105 0.17
106 0.17
107 0.17
108 0.19
109 0.18
110 0.19
111 0.18
112 0.13
113 0.12
114 0.12
115 0.11
116 0.09
117 0.09
118 0.11
119 0.11
120 0.14
121 0.14
122 0.14
123 0.14
124 0.14
125 0.13
126 0.12
127 0.11
128 0.08
129 0.08
130 0.07
131 0.07
132 0.09
133 0.11
134 0.09
135 0.1
136 0.1
137 0.12
138 0.13
139 0.13
140 0.12
141 0.11
142 0.13
143 0.12
144 0.11
145 0.09
146 0.1
147 0.13
148 0.13
149 0.15
150 0.17
151 0.21
152 0.24
153 0.26
154 0.29
155 0.32
156 0.31
157 0.31
158 0.31
159 0.28
160 0.27
161 0.28
162 0.28
163 0.27
164 0.3
165 0.31
166 0.32
167 0.34
168 0.34
169 0.35
170 0.33
171 0.33
172 0.34
173 0.39
174 0.4
175 0.42
176 0.42
177 0.46
178 0.45
179 0.41
180 0.43
181 0.37
182 0.32
183 0.29
184 0.29
185 0.27
186 0.3
187 0.31
188 0.3
189 0.29
190 0.29
191 0.3
192 0.32
193 0.31
194 0.34
195 0.37
196 0.38
197 0.48
198 0.55
199 0.57
200 0.59
201 0.6
202 0.59
203 0.56
204 0.49
205 0.41
206 0.41
207 0.43
208 0.43
209 0.4
210 0.35
211 0.36
212 0.42
213 0.5
214 0.5
215 0.5
216 0.51
217 0.55
218 0.63
219 0.65
220 0.68
221 0.62
222 0.64
223 0.67
224 0.68
225 0.64
226 0.65
227 0.68
228 0.68
229 0.74
230 0.72
231 0.72
232 0.74
233 0.8
234 0.8
235 0.81