Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0HT98

Protein Details
Accession A0A0L0HT98    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
24-46NISLGKDSKPKPPQSNRPGSSKPHydrophilic
220-245IIPYRDAKSKPRRRRTRSSKFAPHYFHydrophilic
NLS Segment(s)
PositionSequence
227-237KSKPRRRRTRS
Subcellular Location(s) nucl 15.5, cyto_nucl 10, mito 6, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012388  CABLES1/2  
IPR013763  Cyclin-like_dom  
IPR036915  Cyclin-like_sf  
IPR006671  Cyclin_N  
Gene Ontology GO:0051726  P:regulation of cell cycle  
Pfam View protein in Pfam  
PF00134  Cyclin_N  
CDD cd20556  CYCLIN_CABLES  
Amino Acid Sequences MEDSPQPERKSANRRAAALSFLANISLGKDSKPKPPQSNRPGSSKPVSPAAQDVPDIAVEKPRQSASQNGVGVEELIPPNVVDTVQYEKAPPVQRQYNEKEKAAISFLASISLDASSDKEKVPSVEQVPLQFPVPLGGSFASTGFSETMQSLGVSNTPQASYMPPAYQIYSGRVLNRQRDSTSRRGSLTDVGSVSPCNTMSGHRVTLTTVTGAPLSVFSIIPYRDAKSKPRRRRTRSSKFAPHYFDKIGFNLNMDAVKRRKFAQSYAHLLEPALSLEPKTVENSLYHPFFLDDPELRTGKHRTVITLPCFMGSIIQYSKPSDIKKELNEHFRETHPTVDSTLTLTQIRRLKDRLLKVGEMQDLELSSVACAYVYFEKLVLKNLVSKETRRLVAAVCLFLAAKVNDPKEVNYTKLLETMEKVLDVAPKEVMANEFPIYTALEFTLFVPLWEVMPHLERIIDASASHNTIEDYIENKTFFMHLFHLKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.66
3 0.63
4 0.57
5 0.48
6 0.4
7 0.3
8 0.25
9 0.21
10 0.16
11 0.14
12 0.12
13 0.14
14 0.13
15 0.14
16 0.22
17 0.25
18 0.35
19 0.45
20 0.52
21 0.59
22 0.69
23 0.78
24 0.81
25 0.89
26 0.83
27 0.82
28 0.78
29 0.75
30 0.69
31 0.64
32 0.56
33 0.53
34 0.51
35 0.43
36 0.43
37 0.4
38 0.36
39 0.31
40 0.28
41 0.21
42 0.21
43 0.21
44 0.16
45 0.19
46 0.19
47 0.21
48 0.23
49 0.24
50 0.25
51 0.26
52 0.33
53 0.31
54 0.38
55 0.37
56 0.34
57 0.33
58 0.31
59 0.29
60 0.22
61 0.2
62 0.12
63 0.11
64 0.11
65 0.1
66 0.11
67 0.1
68 0.09
69 0.06
70 0.08
71 0.14
72 0.16
73 0.17
74 0.17
75 0.18
76 0.26
77 0.31
78 0.31
79 0.33
80 0.39
81 0.43
82 0.51
83 0.58
84 0.61
85 0.6
86 0.58
87 0.54
88 0.47
89 0.44
90 0.38
91 0.31
92 0.22
93 0.19
94 0.18
95 0.16
96 0.15
97 0.13
98 0.11
99 0.1
100 0.09
101 0.07
102 0.09
103 0.09
104 0.11
105 0.11
106 0.12
107 0.13
108 0.15
109 0.17
110 0.22
111 0.22
112 0.25
113 0.27
114 0.28
115 0.28
116 0.27
117 0.25
118 0.2
119 0.17
120 0.14
121 0.13
122 0.1
123 0.1
124 0.09
125 0.09
126 0.09
127 0.09
128 0.09
129 0.07
130 0.09
131 0.08
132 0.08
133 0.08
134 0.08
135 0.08
136 0.07
137 0.07
138 0.07
139 0.06
140 0.07
141 0.07
142 0.08
143 0.08
144 0.08
145 0.08
146 0.08
147 0.09
148 0.12
149 0.13
150 0.13
151 0.14
152 0.14
153 0.15
154 0.17
155 0.16
156 0.16
157 0.18
158 0.19
159 0.19
160 0.24
161 0.28
162 0.33
163 0.36
164 0.36
165 0.34
166 0.4
167 0.45
168 0.48
169 0.5
170 0.46
171 0.43
172 0.42
173 0.41
174 0.39
175 0.34
176 0.27
177 0.21
178 0.18
179 0.17
180 0.16
181 0.15
182 0.11
183 0.09
184 0.08
185 0.08
186 0.09
187 0.12
188 0.15
189 0.15
190 0.15
191 0.15
192 0.14
193 0.15
194 0.14
195 0.12
196 0.09
197 0.08
198 0.08
199 0.07
200 0.07
201 0.06
202 0.06
203 0.06
204 0.05
205 0.05
206 0.08
207 0.08
208 0.1
209 0.12
210 0.13
211 0.17
212 0.19
213 0.28
214 0.37
215 0.48
216 0.56
217 0.66
218 0.75
219 0.79
220 0.88
221 0.9
222 0.9
223 0.89
224 0.88
225 0.87
226 0.82
227 0.8
228 0.74
229 0.66
230 0.58
231 0.5
232 0.43
233 0.34
234 0.29
235 0.25
236 0.19
237 0.17
238 0.13
239 0.12
240 0.11
241 0.1
242 0.14
243 0.15
244 0.18
245 0.18
246 0.2
247 0.24
248 0.25
249 0.29
250 0.33
251 0.36
252 0.39
253 0.4
254 0.39
255 0.34
256 0.32
257 0.29
258 0.2
259 0.14
260 0.08
261 0.06
262 0.06
263 0.06
264 0.07
265 0.07
266 0.08
267 0.08
268 0.09
269 0.1
270 0.13
271 0.16
272 0.16
273 0.15
274 0.14
275 0.14
276 0.14
277 0.14
278 0.14
279 0.11
280 0.12
281 0.16
282 0.16
283 0.16
284 0.19
285 0.21
286 0.21
287 0.25
288 0.23
289 0.22
290 0.29
291 0.35
292 0.35
293 0.36
294 0.34
295 0.28
296 0.28
297 0.25
298 0.2
299 0.14
300 0.14
301 0.11
302 0.13
303 0.13
304 0.14
305 0.17
306 0.2
307 0.21
308 0.23
309 0.27
310 0.3
311 0.35
312 0.42
313 0.45
314 0.5
315 0.52
316 0.51
317 0.48
318 0.45
319 0.46
320 0.39
321 0.37
322 0.3
323 0.28
324 0.25
325 0.24
326 0.22
327 0.18
328 0.17
329 0.15
330 0.16
331 0.15
332 0.2
333 0.24
334 0.25
335 0.27
336 0.29
337 0.35
338 0.4
339 0.46
340 0.48
341 0.48
342 0.48
343 0.47
344 0.49
345 0.44
346 0.37
347 0.31
348 0.23
349 0.18
350 0.17
351 0.14
352 0.09
353 0.06
354 0.06
355 0.05
356 0.04
357 0.04
358 0.06
359 0.09
360 0.1
361 0.1
362 0.11
363 0.14
364 0.15
365 0.19
366 0.19
367 0.17
368 0.22
369 0.23
370 0.3
371 0.3
372 0.31
373 0.35
374 0.39
375 0.39
376 0.35
377 0.34
378 0.28
379 0.33
380 0.32
381 0.25
382 0.2
383 0.19
384 0.18
385 0.16
386 0.19
387 0.12
388 0.15
389 0.2
390 0.21
391 0.25
392 0.26
393 0.28
394 0.32
395 0.34
396 0.31
397 0.3
398 0.32
399 0.28
400 0.31
401 0.31
402 0.25
403 0.24
404 0.25
405 0.22
406 0.19
407 0.18
408 0.16
409 0.19
410 0.19
411 0.18
412 0.15
413 0.14
414 0.15
415 0.15
416 0.16
417 0.13
418 0.14
419 0.14
420 0.13
421 0.13
422 0.13
423 0.13
424 0.12
425 0.11
426 0.09
427 0.09
428 0.1
429 0.1
430 0.15
431 0.13
432 0.13
433 0.14
434 0.14
435 0.14
436 0.14
437 0.14
438 0.11
439 0.14
440 0.15
441 0.13
442 0.13
443 0.12
444 0.14
445 0.16
446 0.14
447 0.12
448 0.14
449 0.17
450 0.18
451 0.18
452 0.16
453 0.14
454 0.15
455 0.16
456 0.14
457 0.13
458 0.16
459 0.2
460 0.2
461 0.19
462 0.19
463 0.19
464 0.18
465 0.19
466 0.2