FuNGI

A0A0L0HT98

Protein Details

Accession

A0A0L0HT98

Localization Confidence

Medium

Confidence Score

14.4

NoLS Segment(s)

Position	Sequence	Protein Nature
24-46	NISLGKDSKPKPPQSNRPGSSKP	Hydrophilic
220-245	IIPYRDAKSKPRRRRTRSSKFAPHYF	Hydrophilic

NLS Segment(s)

Position	Sequence
227-237	KSKPRRRRTRS

Subcellular Location(s)

nucl 15.5, cyto_nucl 10, mito 6, cyto 3.5

Family & Domain DBs

InterPro	View protein in InterPro IPR012388 CABLES1/2 IPR013763 Cyclin-like_dom IPR036915 Cyclin-like_sf IPR006671 Cyclin_N
Gene Ontology	GO:0051726 P:regulation of cell cycle
Pfam	View protein in Pfam PF00134 Cyclin_N
CDD	cd20556 CYCLIN_CABLES

Amino Acid Sequences

MEDSPQPERKSANRRAAALSFLANISLGKDSKPKPPQSNRPGSSKPVSPAAQDVPDIAVEKPRQSASQNGVGVEELIPPNVVDTVQYEKAPPVQRQYNEKEKAAISFLASISLDASSDKEKVPSVEQVPLQFPVPLGGSFASTGFSETMQSLGVSNTPQASYMPPAYQIYSGRVLNRQRDSTSRRGSLTDVGSVSPCNTMSGHRVTLTTVTGAPLSVFSIIPYRDAKSKPRRRRTRSSKFAPHYFDKIGFNLNMDAVKRRKFAQSYAHLLEPALSLEPKTVENSLYHPFFLDDPELRTGKHRTVITLPCFMGSIIQYSKPSDIKKELNEHFRETHPTVDSTLTLTQIRRLKDRLLKVGEMQDLELSSVACAYVYFEKLVLKNLVSKETRRLVAAVCLFLAAKVNDPKEVNYTKLLETMEKVLDVAPKEVMANEFPIYTALEFTLFVPLWEVMPHLERIIDASASHNTIEDYIENKTFFMHLFHLKD

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.63
2	0.66
3	0.63
4	0.57
5	0.48
6	0.4
7	0.3
8	0.25
9	0.21
10	0.16
11	0.14
12	0.12
13	0.14
14	0.13
15	0.14
16	0.22
17	0.25
18	0.35
19	0.45
20	0.52
21	0.59
22	0.69
23	0.78
24	0.81
25	0.89
26	0.83
27	0.82
28	0.78
29	0.75
30	0.69
31	0.64
32	0.56
33	0.53
34	0.51
35	0.43
36	0.43
37	0.4
38	0.36
39	0.31
40	0.28
41	0.21
42	0.21
43	0.21
44	0.16
45	0.19
46	0.19
47	0.21
48	0.23
49	0.24
50	0.25
51	0.26
52	0.33
53	0.31
54	0.38
55	0.37
56	0.34
57	0.33
58	0.31
59	0.29
60	0.22
61	0.2
62	0.12
63	0.11
64	0.11
65	0.1
66	0.11
67	0.1
68	0.09
69	0.06
70	0.08
71	0.14
72	0.16
73	0.17
74	0.17
75	0.18
76	0.26
77	0.31
78	0.31
79	0.33
80	0.39
81	0.43
82	0.51
83	0.58
84	0.61
85	0.6
86	0.58
87	0.54
88	0.47
89	0.44
90	0.38
91	0.31
92	0.22
93	0.19
94	0.18
95	0.16
96	0.15
97	0.13
98	0.11
99	0.1
100	0.09
101	0.07
102	0.09
103	0.09
104	0.11
105	0.11
106	0.12
107	0.13
108	0.15
109	0.17
110	0.22
111	0.22
112	0.25
113	0.27
114	0.28
115	0.28
116	0.27
117	0.25
118	0.2
119	0.17
120	0.14
121	0.13
122	0.1
123	0.1
124	0.09
125	0.09
126	0.09
127	0.09
128	0.09
129	0.07
130	0.09
131	0.08
132	0.08
133	0.08
134	0.08
135	0.08
136	0.07
137	0.07
138	0.07
139	0.06
140	0.07
141	0.07
142	0.08
143	0.08
144	0.08
145	0.08
146	0.08
147	0.09
148	0.12
149	0.13
150	0.13
151	0.14
152	0.14
153	0.15
154	0.17
155	0.16
156	0.16
157	0.18
158	0.19
159	0.19
160	0.24
161	0.28
162	0.33
163	0.36
164	0.36
165	0.34
166	0.4
167	0.45
168	0.48
169	0.5
170	0.46
171	0.43
172	0.42
173	0.41
174	0.39
175	0.34
176	0.27
177	0.21
178	0.18
179	0.17
180	0.16
181	0.15
182	0.11
183	0.09
184	0.08
185	0.08
186	0.09
187	0.12
188	0.15
189	0.15
190	0.15
191	0.15
192	0.14
193	0.15
194	0.14
195	0.12
196	0.09
197	0.08
198	0.08
199	0.07
200	0.07
201	0.06
202	0.06
203	0.06
204	0.05
205	0.05
206	0.08
207	0.08
208	0.1
209	0.12
210	0.13
211	0.17
212	0.19
213	0.28
214	0.37
215	0.48
216	0.56
217	0.66
218	0.75
219	0.79
220	0.88
221	0.9
222	0.9
223	0.89
224	0.88
225	0.87
226	0.82
227	0.8
228	0.74
229	0.66
230	0.58
231	0.5
232	0.43
233	0.34
234	0.29
235	0.25
236	0.19
237	0.17
238	0.13
239	0.12
240	0.11
241	0.1
242	0.14
243	0.15
244	0.18
245	0.18
246	0.2
247	0.24
248	0.25
249	0.29
250	0.33
251	0.36
252	0.39
253	0.4
254	0.39
255	0.34
256	0.32
257	0.29
258	0.2
259	0.14
260	0.08
261	0.06
262	0.06
263	0.06
264	0.07
265	0.07
266	0.08
267	0.08
268	0.09
269	0.1
270	0.13
271	0.16
272	0.16
273	0.15
274	0.14
275	0.14
276	0.14
277	0.14
278	0.14
279	0.11
280	0.12
281	0.16
282	0.16
283	0.16
284	0.19
285	0.21
286	0.21
287	0.25
288	0.23
289	0.22
290	0.29
291	0.35
292	0.35
293	0.36
294	0.34
295	0.28
296	0.28
297	0.25
298	0.2
299	0.14
300	0.14
301	0.11
302	0.13
303	0.13
304	0.14
305	0.17
306	0.2
307	0.21
308	0.23
309	0.27
310	0.3
311	0.35
312	0.42
313	0.45
314	0.5
315	0.52
316	0.51
317	0.48
318	0.45
319	0.46
320	0.39
321	0.37
322	0.3
323	0.28
324	0.25
325	0.24
326	0.22
327	0.18
328	0.17
329	0.15
330	0.16
331	0.15
332	0.2
333	0.24
334	0.25
335	0.27
336	0.29
337	0.35
338	0.4
339	0.46
340	0.48
341	0.48
342	0.48
343	0.47
344	0.49
345	0.44
346	0.37
347	0.31
348	0.23
349	0.18
350	0.17
351	0.14
352	0.09
353	0.06
354	0.06
355	0.05
356	0.04
357	0.04
358	0.06
359	0.09
360	0.1
361	0.1
362	0.11
363	0.14
364	0.15
365	0.19
366	0.19
367	0.17
368	0.22
369	0.23
370	0.3
371	0.3
372	0.31
373	0.35
374	0.39
375	0.39
376	0.35
377	0.34
378	0.28
379	0.33
380	0.32
381	0.25
382	0.2
383	0.19
384	0.18
385	0.16
386	0.19
387	0.12
388	0.15
389	0.2
390	0.21
391	0.25
392	0.26
393	0.28
394	0.32
395	0.34
396	0.31
397	0.3
398	0.32
399	0.28
400	0.31
401	0.31
402	0.25
403	0.24
404	0.25
405	0.22
406	0.19
407	0.18
408	0.16
409	0.19
410	0.19
411	0.18
412	0.15
413	0.14
414	0.15
415	0.15
416	0.16
417	0.13
418	0.14
419	0.14
420	0.13
421	0.13
422	0.13
423	0.13
424	0.12
425	0.11
426	0.09
427	0.09
428	0.1
429	0.1
430	0.15
431	0.13
432	0.13
433	0.14
434	0.14
435	0.14
436	0.14
437	0.14
438	0.11
439	0.14
440	0.15
441	0.13
442	0.13
443	0.12
444	0.14
445	0.16
446	0.14
447	0.12
448	0.14
449	0.17
450	0.18
451	0.18
452	0.16
453	0.14
454	0.15
455	0.16
456	0.14
457	0.13
458	0.16
459	0.2
460	0.2
461	0.19
462	0.19
463	0.19
464	0.18
465	0.19
466	0.2

A0A0L0HT98

3D AlphaFold-predicted Structure Viewer