Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L0HCR9

Protein Details
Accession A0A0L0HCR9    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
19-45NPQLLKKNSSRRKPWAQLRKKFCCKCLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10mito 10mito_nucl 10
Family & Domain DBs
Amino Acid Sequences MSNSDCVQSTAISLNKAINPQLLKKNSSRRKPWAQLRKKFCCKCLEQRRLSSDITPRTDAVGGSSTKRSLSRHQGWFYTTQLVCRVICITGPLCGGAITDFYYDRY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.23
4 0.22
5 0.21
6 0.22
7 0.27
8 0.35
9 0.36
10 0.38
11 0.43
12 0.53
13 0.58
14 0.64
15 0.67
16 0.67
17 0.73
18 0.79
19 0.82
20 0.82
21 0.84
22 0.84
23 0.85
24 0.87
25 0.87
26 0.81
27 0.76
28 0.72
29 0.68
30 0.69
31 0.71
32 0.7
33 0.65
34 0.67
35 0.66
36 0.62
37 0.57
38 0.49
39 0.44
40 0.39
41 0.36
42 0.32
43 0.28
44 0.25
45 0.25
46 0.21
47 0.16
48 0.14
49 0.12
50 0.13
51 0.14
52 0.13
53 0.14
54 0.17
55 0.18
56 0.22
57 0.31
58 0.38
59 0.44
60 0.47
61 0.48
62 0.48
63 0.48
64 0.43
65 0.41
66 0.32
67 0.26
68 0.26
69 0.27
70 0.24
71 0.23
72 0.22
73 0.14
74 0.15
75 0.16
76 0.13
77 0.13
78 0.14
79 0.13
80 0.12
81 0.11
82 0.12
83 0.09
84 0.09
85 0.09
86 0.1