Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L0HRN3

Protein Details
Accession A0A0L0HRN3    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
293-312GRQRRQIWRGKDKRAFGRSRBasic
NLS Segment(s)
PositionSequence
211-219RLPRAPEKR
Subcellular Location(s) nucl 23, cyto 3
Family & Domain DBs
Amino Acid Sequences MTFYNQEQSTPTTSTELAELLASMNLSTTGSPPPAPSSARRTFRRQSSGPLTPTTTAEDPAPERSRDAGSEPVEGQGITPGQRAAALFGVGGLSGQAGQRGHWTGRRGTSPATSPTKPLARPRLFQRSATTQVGRSSTMAGSSSLPCPGTPDPRRRLVRHRTDPTLTPSSRNPRPLAGTKRPCTTPPSLSPTSIRSRSGHPNRVIAHQSRRLPRAPEKRRSPALFISSLRACDHLSQRARRTASGQAHSELGMESESLPKRLRRVGLDTGFDVGLERYVQESESDSEGEEMLGRQRRQIWRGKDKRAFGRSRTVGNMDDNGAFESFFGAGGLAMDPEEPEAVATDRWVLSPVAGSPSLFSIPSFAPFPDPASPCGKQAERLQAAKTMDMLVQSMEANLKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.22
3 0.19
4 0.15
5 0.12
6 0.11
7 0.09
8 0.09
9 0.08
10 0.07
11 0.06
12 0.06
13 0.07
14 0.07
15 0.08
16 0.11
17 0.13
18 0.14
19 0.15
20 0.19
21 0.23
22 0.26
23 0.29
24 0.35
25 0.43
26 0.51
27 0.56
28 0.6
29 0.65
30 0.71
31 0.75
32 0.68
33 0.68
34 0.68
35 0.71
36 0.65
37 0.6
38 0.54
39 0.46
40 0.45
41 0.41
42 0.33
43 0.26
44 0.23
45 0.23
46 0.22
47 0.29
48 0.31
49 0.27
50 0.27
51 0.28
52 0.3
53 0.27
54 0.29
55 0.28
56 0.25
57 0.28
58 0.27
59 0.25
60 0.23
61 0.21
62 0.18
63 0.14
64 0.13
65 0.11
66 0.12
67 0.11
68 0.1
69 0.12
70 0.12
71 0.11
72 0.1
73 0.09
74 0.08
75 0.08
76 0.08
77 0.06
78 0.06
79 0.04
80 0.03
81 0.04
82 0.04
83 0.07
84 0.07
85 0.08
86 0.11
87 0.14
88 0.17
89 0.2
90 0.24
91 0.26
92 0.3
93 0.33
94 0.32
95 0.31
96 0.33
97 0.32
98 0.36
99 0.38
100 0.34
101 0.34
102 0.37
103 0.4
104 0.41
105 0.45
106 0.48
107 0.47
108 0.51
109 0.57
110 0.62
111 0.59
112 0.57
113 0.54
114 0.5
115 0.52
116 0.52
117 0.45
118 0.36
119 0.37
120 0.36
121 0.31
122 0.25
123 0.21
124 0.16
125 0.15
126 0.14
127 0.12
128 0.12
129 0.13
130 0.13
131 0.12
132 0.12
133 0.11
134 0.15
135 0.17
136 0.25
137 0.3
138 0.38
139 0.42
140 0.51
141 0.57
142 0.57
143 0.65
144 0.66
145 0.7
146 0.71
147 0.72
148 0.68
149 0.65
150 0.64
151 0.6
152 0.58
153 0.47
154 0.4
155 0.4
156 0.42
157 0.44
158 0.45
159 0.4
160 0.34
161 0.38
162 0.44
163 0.46
164 0.49
165 0.53
166 0.52
167 0.54
168 0.53
169 0.5
170 0.47
171 0.43
172 0.38
173 0.34
174 0.39
175 0.37
176 0.36
177 0.36
178 0.36
179 0.37
180 0.34
181 0.31
182 0.25
183 0.28
184 0.38
185 0.44
186 0.48
187 0.43
188 0.46
189 0.45
190 0.48
191 0.48
192 0.41
193 0.4
194 0.38
195 0.43
196 0.42
197 0.44
198 0.43
199 0.44
200 0.49
201 0.54
202 0.57
203 0.6
204 0.63
205 0.67
206 0.71
207 0.68
208 0.63
209 0.57
210 0.51
211 0.45
212 0.38
213 0.36
214 0.29
215 0.28
216 0.24
217 0.2
218 0.17
219 0.17
220 0.2
221 0.24
222 0.29
223 0.34
224 0.38
225 0.43
226 0.44
227 0.41
228 0.41
229 0.41
230 0.42
231 0.4
232 0.38
233 0.32
234 0.31
235 0.31
236 0.28
237 0.19
238 0.12
239 0.08
240 0.06
241 0.06
242 0.11
243 0.12
244 0.14
245 0.16
246 0.18
247 0.21
248 0.25
249 0.28
250 0.26
251 0.32
252 0.39
253 0.41
254 0.41
255 0.38
256 0.35
257 0.32
258 0.27
259 0.21
260 0.12
261 0.09
262 0.07
263 0.07
264 0.06
265 0.06
266 0.07
267 0.07
268 0.09
269 0.1
270 0.12
271 0.12
272 0.11
273 0.11
274 0.11
275 0.1
276 0.09
277 0.07
278 0.12
279 0.18
280 0.18
281 0.2
282 0.28
283 0.34
284 0.4
285 0.48
286 0.52
287 0.57
288 0.67
289 0.75
290 0.75
291 0.76
292 0.8
293 0.81
294 0.77
295 0.7
296 0.71
297 0.64
298 0.61
299 0.57
300 0.5
301 0.43
302 0.4
303 0.37
304 0.29
305 0.26
306 0.22
307 0.2
308 0.17
309 0.14
310 0.11
311 0.1
312 0.08
313 0.07
314 0.06
315 0.05
316 0.05
317 0.05
318 0.06
319 0.05
320 0.05
321 0.05
322 0.05
323 0.05
324 0.06
325 0.05
326 0.05
327 0.06
328 0.07
329 0.07
330 0.08
331 0.1
332 0.1
333 0.11
334 0.12
335 0.11
336 0.1
337 0.12
338 0.13
339 0.14
340 0.14
341 0.14
342 0.13
343 0.15
344 0.16
345 0.15
346 0.13
347 0.13
348 0.13
349 0.16
350 0.16
351 0.15
352 0.18
353 0.18
354 0.22
355 0.27
356 0.28
357 0.29
358 0.34
359 0.35
360 0.34
361 0.4
362 0.38
363 0.36
364 0.42
365 0.49
366 0.49
367 0.51
368 0.5
369 0.49
370 0.49
371 0.44
372 0.38
373 0.29
374 0.23
375 0.21
376 0.19
377 0.13
378 0.13
379 0.12
380 0.12