Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L0HM72

Protein Details
Accession A0A0L0HM72    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
13-32SLCPRKRTFLPVKRNPNGSEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10, mito 10, mito_nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR006993  Glut_rich_SH3-bd  
IPR036249  Thioredoxin-like_sf  
Pfam View protein in Pfam  
PF04908  SH3BGR  
PROSITE View protein in PROSITE  
PS51354  GLUTAREDOXIN_2  
Amino Acid Sequences MSPFAPPTLNEFSLCPRKRTFLPVKRNPNGSELKEGSLGGRSTLWQQGGMGHLSRRGSNFPQQTSLRHPRNKMAPRVTIYYSSVSGALQVKKQQTRVQDILAARKVEYEMVDVAADEDAKDYMYRKSGKNTLPQIFVDGEYKGGHDELDEANEIGEVPQWLGLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.41
3 0.37
4 0.41
5 0.43
6 0.51
7 0.55
8 0.54
9 0.63
10 0.68
11 0.77
12 0.78
13 0.81
14 0.73
15 0.69
16 0.66
17 0.58
18 0.56
19 0.47
20 0.42
21 0.37
22 0.35
23 0.29
24 0.25
25 0.22
26 0.15
27 0.13
28 0.12
29 0.14
30 0.17
31 0.17
32 0.13
33 0.13
34 0.13
35 0.14
36 0.15
37 0.14
38 0.11
39 0.13
40 0.14
41 0.15
42 0.16
43 0.18
44 0.2
45 0.27
46 0.31
47 0.3
48 0.35
49 0.35
50 0.37
51 0.41
52 0.48
53 0.48
54 0.49
55 0.49
56 0.48
57 0.57
58 0.61
59 0.6
60 0.56
61 0.52
62 0.49
63 0.51
64 0.47
65 0.39
66 0.33
67 0.27
68 0.22
69 0.17
70 0.14
71 0.11
72 0.11
73 0.13
74 0.12
75 0.12
76 0.16
77 0.2
78 0.23
79 0.26
80 0.27
81 0.28
82 0.35
83 0.35
84 0.32
85 0.32
86 0.31
87 0.34
88 0.34
89 0.31
90 0.23
91 0.22
92 0.21
93 0.17
94 0.16
95 0.12
96 0.08
97 0.09
98 0.08
99 0.08
100 0.08
101 0.07
102 0.07
103 0.05
104 0.05
105 0.05
106 0.05
107 0.06
108 0.07
109 0.08
110 0.14
111 0.18
112 0.2
113 0.27
114 0.34
115 0.39
116 0.47
117 0.54
118 0.52
119 0.52
120 0.5
121 0.47
122 0.4
123 0.37
124 0.29
125 0.21
126 0.18
127 0.14
128 0.14
129 0.12
130 0.11
131 0.09
132 0.08
133 0.1
134 0.1
135 0.12
136 0.13
137 0.12
138 0.11
139 0.12
140 0.11
141 0.09
142 0.1
143 0.08
144 0.07