Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0HMQ7

Protein Details
Accession A0A0L0HMQ7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
47-73ESTSERPRTESRTKRPRREQVPWAEMRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, plas 10, cyto 3, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013261  Tim21  
IPR038552  Tim21_IMS_sf  
Gene Ontology GO:0005744  C:TIM23 mitochondrial import inner membrane translocase complex  
GO:0030150  P:protein import into mitochondrial matrix  
Pfam View protein in Pfam  
PF08294  TIM21  
Amino Acid Sequences MPIIRHLTHRTNPPAVRYLSAILHLPNKQDTSCRPRRIYASTSAKQESTSERPRTESRTKRPRREQVPWAEMRLSERVAHALQTLGYTGVIIVGLGVIGTAIYSIGLELVDQTDAWKVYDDALERVMNSEEVQKLVGIPMTGLADEGGRRGKSLSHHIVEDPTSGKTLLMKFYIKGAKSSGTVHVEMVQNKETSRWDYQLLLVDIAQHGGSKRVIVTDNRPIFTMSDPERRGWFGFGSARGIRRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.53
3 0.49
4 0.42
5 0.38
6 0.3
7 0.29
8 0.26
9 0.21
10 0.25
11 0.25
12 0.26
13 0.27
14 0.27
15 0.27
16 0.3
17 0.36
18 0.4
19 0.48
20 0.54
21 0.54
22 0.57
23 0.62
24 0.63
25 0.6
26 0.6
27 0.6
28 0.56
29 0.58
30 0.55
31 0.5
32 0.44
33 0.42
34 0.38
35 0.37
36 0.41
37 0.41
38 0.4
39 0.45
40 0.48
41 0.54
42 0.57
43 0.59
44 0.6
45 0.66
46 0.75
47 0.8
48 0.87
49 0.89
50 0.88
51 0.86
52 0.85
53 0.84
54 0.82
55 0.74
56 0.66
57 0.57
58 0.48
59 0.43
60 0.36
61 0.27
62 0.19
63 0.17
64 0.16
65 0.15
66 0.15
67 0.13
68 0.11
69 0.1
70 0.09
71 0.09
72 0.06
73 0.06
74 0.05
75 0.04
76 0.04
77 0.04
78 0.03
79 0.02
80 0.02
81 0.02
82 0.02
83 0.02
84 0.01
85 0.01
86 0.01
87 0.02
88 0.02
89 0.02
90 0.02
91 0.02
92 0.02
93 0.02
94 0.02
95 0.02
96 0.03
97 0.03
98 0.03
99 0.04
100 0.05
101 0.05
102 0.06
103 0.06
104 0.06
105 0.07
106 0.09
107 0.09
108 0.08
109 0.1
110 0.1
111 0.09
112 0.1
113 0.1
114 0.08
115 0.08
116 0.1
117 0.08
118 0.09
119 0.09
120 0.08
121 0.08
122 0.08
123 0.08
124 0.05
125 0.04
126 0.05
127 0.05
128 0.05
129 0.05
130 0.05
131 0.05
132 0.05
133 0.06
134 0.08
135 0.08
136 0.08
137 0.09
138 0.11
139 0.14
140 0.22
141 0.27
142 0.26
143 0.27
144 0.28
145 0.29
146 0.27
147 0.26
148 0.19
149 0.13
150 0.12
151 0.11
152 0.11
153 0.12
154 0.13
155 0.14
156 0.15
157 0.16
158 0.15
159 0.21
160 0.26
161 0.24
162 0.24
163 0.23
164 0.22
165 0.23
166 0.25
167 0.25
168 0.23
169 0.23
170 0.22
171 0.25
172 0.27
173 0.27
174 0.28
175 0.25
176 0.22
177 0.21
178 0.23
179 0.21
180 0.23
181 0.25
182 0.24
183 0.23
184 0.24
185 0.26
186 0.3
187 0.29
188 0.24
189 0.2
190 0.19
191 0.17
192 0.17
193 0.14
194 0.09
195 0.08
196 0.1
197 0.11
198 0.11
199 0.11
200 0.13
201 0.17
202 0.2
203 0.27
204 0.34
205 0.4
206 0.39
207 0.4
208 0.38
209 0.36
210 0.34
211 0.35
212 0.3
213 0.35
214 0.36
215 0.38
216 0.4
217 0.41
218 0.4
219 0.35
220 0.3
221 0.26
222 0.29
223 0.28
224 0.32
225 0.33