Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2DF68

Protein Details
Accession A0A0D2DF68    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
9-29GWVKVAPPPPRKRPVNHDPKAHydrophilic
119-138VQRRRPRTPKSIEQPKPKSRBasic
NLS Segment(s)
PositionSequence
122-136RRPRTPKSIEQPKPK
Subcellular Location(s) nucl 15.5, mito 11, cyto_nucl 8.5
Family & Domain DBs
Amino Acid Sequences MPTILTPQGWVKVAPPPPRKRPVNHDPKAVFRGPLAYLACQSKPPPLNIGGGGNVKGRAEFPYDLSASPEKLRRQGEVNARSKADRSVSAPVMHGGLHPRDDDYDEYDDEVEDIPAPEVQRRRPRTPKSIEQPKPKSRSSPQSQSSRSSQHHSHHHNDRPEHRSHTSSHSRAPSSPSSSSTSSSGASSRSSAPSSRSSASSVSSAHSTKSYHRPAPPGHSRRPSVPAAAPAANPYYSMPRYDHYPAPPGSMPMPMPIPMHVPMPMPAVPAAQPVSSGKGSGSARSLSYSWYNATTPLKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.49
3 0.54
4 0.63
5 0.73
6 0.78
7 0.78
8 0.8
9 0.8
10 0.81
11 0.78
12 0.79
13 0.72
14 0.73
15 0.72
16 0.64
17 0.54
18 0.43
19 0.41
20 0.31
21 0.34
22 0.28
23 0.22
24 0.24
25 0.27
26 0.27
27 0.26
28 0.26
29 0.29
30 0.31
31 0.32
32 0.32
33 0.31
34 0.33
35 0.31
36 0.32
37 0.27
38 0.25
39 0.25
40 0.22
41 0.2
42 0.18
43 0.16
44 0.15
45 0.14
46 0.17
47 0.16
48 0.17
49 0.21
50 0.22
51 0.21
52 0.25
53 0.24
54 0.21
55 0.24
56 0.28
57 0.26
58 0.32
59 0.33
60 0.31
61 0.34
62 0.4
63 0.46
64 0.5
65 0.54
66 0.51
67 0.5
68 0.49
69 0.46
70 0.41
71 0.34
72 0.26
73 0.23
74 0.25
75 0.27
76 0.27
77 0.26
78 0.23
79 0.21
80 0.19
81 0.16
82 0.14
83 0.13
84 0.13
85 0.13
86 0.13
87 0.13
88 0.15
89 0.15
90 0.15
91 0.16
92 0.15
93 0.16
94 0.15
95 0.14
96 0.13
97 0.12
98 0.08
99 0.06
100 0.06
101 0.05
102 0.07
103 0.07
104 0.1
105 0.13
106 0.2
107 0.3
108 0.36
109 0.45
110 0.53
111 0.6
112 0.66
113 0.71
114 0.73
115 0.74
116 0.78
117 0.78
118 0.79
119 0.81
120 0.8
121 0.78
122 0.7
123 0.66
124 0.61
125 0.63
126 0.6
127 0.6
128 0.58
129 0.61
130 0.62
131 0.59
132 0.57
133 0.53
134 0.48
135 0.43
136 0.41
137 0.38
138 0.44
139 0.45
140 0.49
141 0.51
142 0.55
143 0.56
144 0.56
145 0.58
146 0.54
147 0.52
148 0.5
149 0.44
150 0.4
151 0.37
152 0.4
153 0.42
154 0.39
155 0.41
156 0.4
157 0.39
158 0.38
159 0.4
160 0.36
161 0.32
162 0.32
163 0.29
164 0.29
165 0.29
166 0.29
167 0.26
168 0.23
169 0.19
170 0.18
171 0.16
172 0.13
173 0.12
174 0.12
175 0.13
176 0.14
177 0.15
178 0.15
179 0.18
180 0.21
181 0.24
182 0.24
183 0.23
184 0.23
185 0.22
186 0.23
187 0.21
188 0.17
189 0.15
190 0.17
191 0.16
192 0.15
193 0.16
194 0.16
195 0.2
196 0.29
197 0.34
198 0.37
199 0.4
200 0.46
201 0.48
202 0.56
203 0.61
204 0.59
205 0.61
206 0.63
207 0.62
208 0.59
209 0.61
210 0.53
211 0.47
212 0.42
213 0.37
214 0.34
215 0.33
216 0.29
217 0.26
218 0.25
219 0.21
220 0.19
221 0.16
222 0.18
223 0.17
224 0.2
225 0.2
226 0.19
227 0.25
228 0.29
229 0.33
230 0.29
231 0.36
232 0.34
233 0.37
234 0.37
235 0.33
236 0.3
237 0.28
238 0.25
239 0.2
240 0.21
241 0.18
242 0.18
243 0.17
244 0.19
245 0.17
246 0.18
247 0.17
248 0.17
249 0.16
250 0.2
251 0.19
252 0.17
253 0.16
254 0.17
255 0.16
256 0.18
257 0.18
258 0.14
259 0.15
260 0.15
261 0.19
262 0.18
263 0.18
264 0.15
265 0.2
266 0.21
267 0.22
268 0.24
269 0.21
270 0.22
271 0.25
272 0.25
273 0.22
274 0.25
275 0.25
276 0.24
277 0.25
278 0.25
279 0.27