Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2G3S6

Protein Details
Accession A0A0D2G3S6   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
158-179DEHPMARQEKRRREREGVQEKTBasic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, mito_nucl 13, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013170  mRNA_splic_Cwf21_dom  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF08312  cwf21  
CDD cd21372  cwf21_CWC21-like  
Amino Acid Sequences MSSNVGLSTPRGSGTSGYVQRNLSVLKPRAVGIGAPYSLDSARQGPKTRKPDQEILNHDRLRAIEVKVLELREKLEDDELEEEKIDEECDKLREQLTKEMEREKNRDGGRSGGSGARRVDGKGLKSYQVHELAEAKEQESERLRRALGLKPGEIPQDDEHPMARQEKRRREREGVQEKTESVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.25
3 0.3
4 0.32
5 0.35
6 0.35
7 0.34
8 0.35
9 0.32
10 0.27
11 0.3
12 0.31
13 0.3
14 0.31
15 0.31
16 0.3
17 0.29
18 0.25
19 0.19
20 0.2
21 0.16
22 0.15
23 0.15
24 0.15
25 0.14
26 0.14
27 0.13
28 0.13
29 0.18
30 0.22
31 0.29
32 0.35
33 0.44
34 0.52
35 0.59
36 0.63
37 0.64
38 0.67
39 0.67
40 0.69
41 0.68
42 0.67
43 0.68
44 0.6
45 0.53
46 0.47
47 0.4
48 0.34
49 0.28
50 0.22
51 0.16
52 0.16
53 0.18
54 0.19
55 0.2
56 0.17
57 0.15
58 0.15
59 0.13
60 0.14
61 0.12
62 0.11
63 0.11
64 0.11
65 0.13
66 0.13
67 0.12
68 0.11
69 0.1
70 0.09
71 0.09
72 0.08
73 0.05
74 0.05
75 0.06
76 0.08
77 0.09
78 0.09
79 0.11
80 0.14
81 0.16
82 0.22
83 0.26
84 0.28
85 0.29
86 0.36
87 0.4
88 0.42
89 0.44
90 0.39
91 0.41
92 0.38
93 0.4
94 0.33
95 0.31
96 0.28
97 0.24
98 0.23
99 0.19
100 0.2
101 0.2
102 0.19
103 0.17
104 0.16
105 0.16
106 0.2
107 0.2
108 0.22
109 0.24
110 0.25
111 0.28
112 0.28
113 0.3
114 0.3
115 0.3
116 0.28
117 0.24
118 0.25
119 0.23
120 0.26
121 0.24
122 0.19
123 0.19
124 0.19
125 0.22
126 0.25
127 0.27
128 0.26
129 0.28
130 0.28
131 0.28
132 0.31
133 0.33
134 0.35
135 0.36
136 0.34
137 0.34
138 0.36
139 0.35
140 0.33
141 0.31
142 0.25
143 0.26
144 0.27
145 0.25
146 0.24
147 0.23
148 0.26
149 0.29
150 0.34
151 0.38
152 0.47
153 0.57
154 0.66
155 0.72
156 0.77
157 0.79
158 0.81
159 0.82
160 0.83
161 0.8
162 0.75
163 0.7