Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6FTT8

Protein Details
Accession Q6FTT8   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
21-41ISPVLLKKKPSHKGKGGPVEDHydrophilic
NLS Segment(s)
PositionSequence
28-34KKPSHKG
Subcellular Location(s) mito 15.5, mito_nucl 12.333, nucl 8, cyto_nucl 6.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR002661  Ribosome_recyc_fac  
IPR023584  Ribosome_recyc_fac_dom  
IPR036191  RRF_sf  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0032543  P:mitochondrial translation  
KEGG cgr:CAGL0F08943g  -  
Pfam View protein in Pfam  
PF01765  RRF  
Amino Acid Sequences MLALRTSVGLTKNLFTRRLHISPVLLKKKPSHKGKGGPVEDEEIDIVNPSIYVDELVSKFDKSLELYSKELTDKRKGSVNANIFDNLSLKNGALFKEMASTTLKGKGSLLVTVFDPNEVKNIVSAILASGQNLNPERVPTNNQQLKIPLPPPTAESRQNLCKELKTVFEKYKQSPSKNSLGHIRNEVMKKLKSLQKKDESVKKIIQNVEKVHKDYVTKLSEQLKQAEKSVMGQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.32
3 0.35
4 0.4
5 0.41
6 0.42
7 0.38
8 0.39
9 0.43
10 0.53
11 0.57
12 0.51
13 0.53
14 0.56
15 0.64
16 0.68
17 0.69
18 0.68
19 0.68
20 0.75
21 0.81
22 0.83
23 0.76
24 0.7
25 0.62
26 0.56
27 0.47
28 0.38
29 0.28
30 0.18
31 0.15
32 0.12
33 0.1
34 0.06
35 0.06
36 0.05
37 0.05
38 0.05
39 0.05
40 0.05
41 0.08
42 0.09
43 0.12
44 0.12
45 0.12
46 0.12
47 0.13
48 0.14
49 0.12
50 0.17
51 0.2
52 0.22
53 0.24
54 0.24
55 0.26
56 0.27
57 0.29
58 0.29
59 0.31
60 0.3
61 0.3
62 0.36
63 0.36
64 0.38
65 0.42
66 0.43
67 0.38
68 0.38
69 0.37
70 0.3
71 0.29
72 0.25
73 0.17
74 0.13
75 0.1
76 0.08
77 0.09
78 0.1
79 0.1
80 0.11
81 0.11
82 0.09
83 0.12
84 0.12
85 0.12
86 0.12
87 0.13
88 0.12
89 0.18
90 0.18
91 0.15
92 0.15
93 0.16
94 0.15
95 0.16
96 0.15
97 0.1
98 0.11
99 0.12
100 0.11
101 0.09
102 0.09
103 0.07
104 0.08
105 0.08
106 0.07
107 0.06
108 0.06
109 0.06
110 0.05
111 0.05
112 0.04
113 0.06
114 0.06
115 0.06
116 0.07
117 0.07
118 0.1
119 0.11
120 0.12
121 0.1
122 0.11
123 0.12
124 0.13
125 0.18
126 0.19
127 0.29
128 0.32
129 0.33
130 0.32
131 0.33
132 0.34
133 0.33
134 0.31
135 0.26
136 0.24
137 0.23
138 0.25
139 0.29
140 0.31
141 0.31
142 0.33
143 0.33
144 0.39
145 0.41
146 0.41
147 0.38
148 0.35
149 0.33
150 0.3
151 0.32
152 0.3
153 0.33
154 0.35
155 0.41
156 0.45
157 0.46
158 0.55
159 0.56
160 0.55
161 0.57
162 0.57
163 0.59
164 0.55
165 0.55
166 0.54
167 0.51
168 0.49
169 0.46
170 0.43
171 0.41
172 0.41
173 0.43
174 0.4
175 0.37
176 0.37
177 0.4
178 0.45
179 0.48
180 0.54
181 0.6
182 0.63
183 0.69
184 0.75
185 0.77
186 0.75
187 0.72
188 0.71
189 0.66
190 0.64
191 0.62
192 0.6
193 0.57
194 0.59
195 0.62
196 0.6
197 0.57
198 0.53
199 0.49
200 0.45
201 0.43
202 0.44
203 0.39
204 0.35
205 0.38
206 0.43
207 0.45
208 0.47
209 0.49
210 0.48
211 0.46
212 0.47
213 0.45