Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6FRN5

Protein Details
Accession Q6FRN5    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
352-377VVRHAIKLRGKKRRKGNENEPQPKQLBasic
NLS Segment(s)
PositionSequence
357-367IKLRGKKRRKG
Subcellular Location(s) mito_nucl 11.832, nucl 11.5, mito 10.5, cyto_nucl 10.333, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR030382  MeTrfase_TRM5/TYW2  
IPR029063  SAM-dependent_MTases_sf  
IPR025792  tRNA_Gua_MeTrfase_euk  
Gene Ontology GO:0005759  C:mitochondrial matrix  
GO:0005634  C:nucleus  
GO:0052906  F:tRNA (guanine(37)-N(1))-methyltransferase activity  
GO:0070901  P:mitochondrial tRNA methylation  
GO:0002939  P:tRNA N1-guanine methylation  
KEGG cgr:CAGL0H07183g  -  
Pfam View protein in Pfam  
PF02475  Met_10  
PROSITE View protein in PROSITE  
PS51684  SAM_MT_TRM5_TYW2  
Amino Acid Sequences MHRFFSWFPKYRLVRNWSTMSTQHNMYKYSPPVNRSMKELDRSFFTKKIPLVVVKFKDPRNISEFAKNYKESILRIPRIPHVIKLEYKDGHAPSKTVACDNELVTKGVLLTDKITNVQDVSKVLSQGAVDYLNEKQAELLPYEYTLDYNFWKAEEILRSVLPEEFLDEVPTGFTITGHVAHLNLRNEFKPYDSLIGQVILDKNNKIECVVDKVSSIATQFRTFPMKVIAGDSTNLVVEQKESDCTFRFDFSKVYWNSRLHTEHQRLVTDYFKDGEIVCDVFAGVGPFAVPAGKKPSFVLANDLNPESFKYLQENITLNKVSDFVKPFNHDGAEFIKQSANILDNFREESNGVVRHAIKLRGKKRRKGNENEPQPKQLEQQYKEYIIPKNISHYVMNLPDSALTFLGNFNGVYNNIDPEIYKEMPYVHVHCFEKYENGEEVSMEELHKRVFNRILKEMDCSADILPFEAVAFHLVRKVSPTKPMFCCSFKLPKEVAFKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.65
3 0.67
4 0.6
5 0.6
6 0.56
7 0.52
8 0.48
9 0.46
10 0.44
11 0.42
12 0.41
13 0.4
14 0.44
15 0.44
16 0.49
17 0.49
18 0.47
19 0.53
20 0.59
21 0.57
22 0.55
23 0.57
24 0.55
25 0.58
26 0.58
27 0.51
28 0.48
29 0.51
30 0.5
31 0.46
32 0.42
33 0.4
34 0.37
35 0.41
36 0.4
37 0.42
38 0.44
39 0.5
40 0.51
41 0.53
42 0.58
43 0.55
44 0.59
45 0.55
46 0.54
47 0.5
48 0.5
49 0.45
50 0.48
51 0.5
52 0.47
53 0.51
54 0.46
55 0.42
56 0.44
57 0.43
58 0.35
59 0.41
60 0.44
61 0.42
62 0.45
63 0.48
64 0.47
65 0.53
66 0.52
67 0.47
68 0.44
69 0.45
70 0.45
71 0.46
72 0.48
73 0.41
74 0.42
75 0.42
76 0.38
77 0.39
78 0.35
79 0.32
80 0.27
81 0.31
82 0.3
83 0.27
84 0.25
85 0.22
86 0.24
87 0.24
88 0.28
89 0.24
90 0.24
91 0.21
92 0.2
93 0.17
94 0.16
95 0.15
96 0.1
97 0.11
98 0.12
99 0.13
100 0.14
101 0.15
102 0.14
103 0.14
104 0.15
105 0.14
106 0.13
107 0.16
108 0.16
109 0.15
110 0.15
111 0.15
112 0.14
113 0.13
114 0.13
115 0.1
116 0.08
117 0.09
118 0.1
119 0.13
120 0.13
121 0.12
122 0.11
123 0.14
124 0.15
125 0.15
126 0.15
127 0.12
128 0.12
129 0.14
130 0.13
131 0.1
132 0.1
133 0.1
134 0.1
135 0.12
136 0.11
137 0.1
138 0.11
139 0.11
140 0.14
141 0.15
142 0.17
143 0.16
144 0.17
145 0.17
146 0.17
147 0.17
148 0.13
149 0.1
150 0.1
151 0.1
152 0.1
153 0.1
154 0.1
155 0.09
156 0.09
157 0.09
158 0.07
159 0.06
160 0.05
161 0.05
162 0.06
163 0.07
164 0.07
165 0.08
166 0.08
167 0.1
168 0.16
169 0.17
170 0.18
171 0.19
172 0.2
173 0.22
174 0.22
175 0.21
176 0.18
177 0.17
178 0.18
179 0.16
180 0.16
181 0.14
182 0.14
183 0.13
184 0.13
185 0.12
186 0.12
187 0.13
188 0.13
189 0.14
190 0.14
191 0.14
192 0.12
193 0.13
194 0.11
195 0.16
196 0.18
197 0.16
198 0.16
199 0.16
200 0.16
201 0.15
202 0.14
203 0.11
204 0.11
205 0.12
206 0.12
207 0.14
208 0.18
209 0.17
210 0.18
211 0.17
212 0.17
213 0.16
214 0.17
215 0.16
216 0.12
217 0.12
218 0.12
219 0.09
220 0.08
221 0.07
222 0.06
223 0.05
224 0.05
225 0.06
226 0.06
227 0.07
228 0.08
229 0.1
230 0.11
231 0.14
232 0.14
233 0.14
234 0.15
235 0.15
236 0.15
237 0.15
238 0.23
239 0.21
240 0.25
241 0.29
242 0.29
243 0.3
244 0.33
245 0.35
246 0.31
247 0.39
248 0.38
249 0.37
250 0.37
251 0.37
252 0.33
253 0.32
254 0.31
255 0.22
256 0.19
257 0.16
258 0.14
259 0.13
260 0.12
261 0.11
262 0.09
263 0.08
264 0.07
265 0.06
266 0.06
267 0.05
268 0.05
269 0.05
270 0.03
271 0.03
272 0.03
273 0.03
274 0.03
275 0.04
276 0.04
277 0.05
278 0.12
279 0.13
280 0.14
281 0.14
282 0.19
283 0.2
284 0.2
285 0.24
286 0.2
287 0.22
288 0.23
289 0.23
290 0.19
291 0.17
292 0.17
293 0.15
294 0.13
295 0.11
296 0.13
297 0.15
298 0.16
299 0.2
300 0.21
301 0.2
302 0.23
303 0.23
304 0.2
305 0.17
306 0.18
307 0.16
308 0.18
309 0.2
310 0.18
311 0.22
312 0.25
313 0.27
314 0.27
315 0.26
316 0.22
317 0.2
318 0.22
319 0.22
320 0.18
321 0.18
322 0.17
323 0.16
324 0.16
325 0.16
326 0.14
327 0.12
328 0.14
329 0.14
330 0.14
331 0.16
332 0.16
333 0.15
334 0.14
335 0.13
336 0.16
337 0.16
338 0.16
339 0.17
340 0.17
341 0.21
342 0.24
343 0.29
344 0.3
345 0.38
346 0.47
347 0.55
348 0.64
349 0.68
350 0.75
351 0.8
352 0.84
353 0.85
354 0.86
355 0.86
356 0.88
357 0.9
358 0.83
359 0.77
360 0.69
361 0.6
362 0.54
363 0.51
364 0.49
365 0.43
366 0.47
367 0.46
368 0.47
369 0.48
370 0.49
371 0.45
372 0.41
373 0.41
374 0.34
375 0.35
376 0.36
377 0.35
378 0.31
379 0.28
380 0.28
381 0.28
382 0.29
383 0.23
384 0.2
385 0.18
386 0.18
387 0.17
388 0.12
389 0.09
390 0.08
391 0.08
392 0.09
393 0.09
394 0.08
395 0.07
396 0.09
397 0.09
398 0.11
399 0.12
400 0.13
401 0.13
402 0.13
403 0.12
404 0.14
405 0.2
406 0.19
407 0.18
408 0.18
409 0.19
410 0.23
411 0.27
412 0.27
413 0.24
414 0.3
415 0.31
416 0.31
417 0.34
418 0.31
419 0.33
420 0.32
421 0.32
422 0.27
423 0.27
424 0.27
425 0.23
426 0.22
427 0.18
428 0.17
429 0.14
430 0.13
431 0.13
432 0.14
433 0.18
434 0.18
435 0.21
436 0.29
437 0.35
438 0.4
439 0.45
440 0.5
441 0.47
442 0.51
443 0.47
444 0.41
445 0.35
446 0.3
447 0.24
448 0.2
449 0.19
450 0.16
451 0.13
452 0.11
453 0.1
454 0.09
455 0.09
456 0.09
457 0.1
458 0.09
459 0.13
460 0.13
461 0.14
462 0.19
463 0.25
464 0.26
465 0.35
466 0.41
467 0.46
468 0.52
469 0.57
470 0.57
471 0.54
472 0.55
473 0.53
474 0.57
475 0.51
476 0.54
477 0.51
478 0.53