Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2HP98

Protein Details
Accession A0A0D2HP98   
Localization Confidence High
Confidence Score 16
NoLS Segment(s)
PositionSequenceProtein Nature
164-187GPSAAKPAAKKKGKKIKLSFDDPEHydrophilic
NLS Segment(s)
PositionSequence
144-180AKKHKDPPKEKDENPAAGKIGPSAAKPAAKKKGKKIK
Subcellular Location(s) nucl 20, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027911  DUF4604  
Pfam View protein in Pfam  
PF15377  DUF4604  
Amino Acid Sequences MAFNAKNLQYNKQEPSFLRRLKGEVGGLDGRNNVQIPRPKRDRLKTGDDDEDEPVILDERGERVEKAEFERMMKGEDGTPNPSEAEDAGATGAQLAEHQDGENHERQKVTEIGSAANAKKRKVGKVVGGEEEREISDDHRTENAKKHKDPPKEKDENPAAGKIGPSAAKPAAKKKGKKIKLSFDDPEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.53
3 0.56
4 0.52
5 0.51
6 0.46
7 0.46
8 0.44
9 0.45
10 0.39
11 0.29
12 0.3
13 0.3
14 0.28
15 0.27
16 0.24
17 0.2
18 0.2
19 0.2
20 0.16
21 0.18
22 0.26
23 0.3
24 0.39
25 0.46
26 0.52
27 0.61
28 0.68
29 0.7
30 0.69
31 0.73
32 0.71
33 0.69
34 0.67
35 0.6
36 0.54
37 0.46
38 0.39
39 0.29
40 0.22
41 0.17
42 0.11
43 0.09
44 0.07
45 0.06
46 0.06
47 0.08
48 0.09
49 0.09
50 0.1
51 0.12
52 0.14
53 0.17
54 0.21
55 0.2
56 0.2
57 0.23
58 0.22
59 0.21
60 0.2
61 0.17
62 0.14
63 0.16
64 0.17
65 0.17
66 0.17
67 0.16
68 0.16
69 0.15
70 0.13
71 0.1
72 0.1
73 0.06
74 0.06
75 0.05
76 0.05
77 0.05
78 0.05
79 0.04
80 0.03
81 0.03
82 0.04
83 0.04
84 0.05
85 0.05
86 0.05
87 0.07
88 0.11
89 0.16
90 0.16
91 0.17
92 0.17
93 0.17
94 0.2
95 0.2
96 0.19
97 0.16
98 0.16
99 0.15
100 0.17
101 0.2
102 0.18
103 0.22
104 0.22
105 0.2
106 0.25
107 0.28
108 0.3
109 0.33
110 0.37
111 0.38
112 0.45
113 0.48
114 0.48
115 0.45
116 0.41
117 0.36
118 0.32
119 0.25
120 0.17
121 0.14
122 0.09
123 0.13
124 0.13
125 0.14
126 0.18
127 0.21
128 0.23
129 0.32
130 0.41
131 0.45
132 0.48
133 0.57
134 0.62
135 0.7
136 0.77
137 0.76
138 0.77
139 0.78
140 0.75
141 0.76
142 0.73
143 0.7
144 0.63
145 0.56
146 0.47
147 0.39
148 0.37
149 0.28
150 0.24
151 0.18
152 0.16
153 0.18
154 0.2
155 0.24
156 0.28
157 0.36
158 0.44
159 0.52
160 0.59
161 0.65
162 0.72
163 0.76
164 0.84
165 0.84
166 0.85
167 0.85
168 0.85