Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2EJU5

Protein Details
Accession A0A0D2EJU5   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
284-303PKPKEEPKPKEDKNEEKKEABasic
328-351ESSEAKNSKSKKKEEKAADEPEQKHydrophilic
NLS Segment(s)
PositionSequence
284-309PKPKEEPKPKEDKNEEKKEADTKGKE
Subcellular Location(s) plas 11, cyto_nucl 6, nucl 5, cyto 5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR041622  SLATT_fungi  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF18142  SLATT_fungal  
Amino Acid Sequences MPSERTPLLWSPRYPDGDTSDFATDPHAQFCMMTGVPSSAPTPDGKPRPSSKIPPKSLYGRALRQLSKQRFTYYMTASLSNTMLLTQVVLGAALTALGASESSHILITIFGAMNTIIAGLVAYLKSRGQPMRARMYRDDLERVVDEIENSEVMWLGITTGVNGYDDIDTGDRKSGERGAAAVTVRSEVARLTRLYDRAVRNNTVNNPDMYMTGTVDGNYAGATLRNRAAIGSGPPVPLPTPVPAPIAAPVVGTNPGPAIVSGSTPAPAPQPVHDPDESPATAPPKPKEEPKPKEDKNEEKKEADTKGKEKEARDSESDEESSGESSGESSEAKNSKSKKKEEKAADEPEQKGNEQQQEQPQQPPHDPDAEPASDPNVPLKKVAGDAPDGDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.48
3 0.45
4 0.43
5 0.42
6 0.4
7 0.34
8 0.29
9 0.27
10 0.27
11 0.26
12 0.23
13 0.24
14 0.21
15 0.18
16 0.18
17 0.19
18 0.2
19 0.14
20 0.13
21 0.12
22 0.14
23 0.14
24 0.15
25 0.15
26 0.11
27 0.13
28 0.14
29 0.18
30 0.26
31 0.33
32 0.35
33 0.43
34 0.48
35 0.55
36 0.6
37 0.67
38 0.68
39 0.72
40 0.75
41 0.72
42 0.72
43 0.71
44 0.7
45 0.68
46 0.64
47 0.59
48 0.59
49 0.62
50 0.58
51 0.59
52 0.63
53 0.63
54 0.62
55 0.59
56 0.55
57 0.51
58 0.52
59 0.5
60 0.43
61 0.41
62 0.37
63 0.35
64 0.32
65 0.31
66 0.27
67 0.21
68 0.17
69 0.11
70 0.1
71 0.08
72 0.07
73 0.05
74 0.05
75 0.05
76 0.05
77 0.04
78 0.04
79 0.03
80 0.03
81 0.03
82 0.02
83 0.02
84 0.02
85 0.02
86 0.03
87 0.04
88 0.04
89 0.05
90 0.05
91 0.05
92 0.06
93 0.06
94 0.06
95 0.07
96 0.07
97 0.06
98 0.06
99 0.06
100 0.06
101 0.06
102 0.06
103 0.03
104 0.03
105 0.03
106 0.02
107 0.03
108 0.04
109 0.04
110 0.05
111 0.06
112 0.07
113 0.12
114 0.14
115 0.19
116 0.25
117 0.31
118 0.41
119 0.44
120 0.48
121 0.45
122 0.51
123 0.48
124 0.45
125 0.43
126 0.33
127 0.31
128 0.26
129 0.25
130 0.19
131 0.16
132 0.13
133 0.1
134 0.1
135 0.08
136 0.07
137 0.06
138 0.05
139 0.05
140 0.04
141 0.03
142 0.03
143 0.04
144 0.04
145 0.04
146 0.04
147 0.05
148 0.05
149 0.05
150 0.06
151 0.05
152 0.05
153 0.06
154 0.06
155 0.07
156 0.07
157 0.09
158 0.08
159 0.09
160 0.1
161 0.12
162 0.12
163 0.12
164 0.12
165 0.11
166 0.13
167 0.12
168 0.11
169 0.09
170 0.09
171 0.08
172 0.08
173 0.07
174 0.05
175 0.06
176 0.08
177 0.08
178 0.11
179 0.13
180 0.15
181 0.16
182 0.23
183 0.25
184 0.29
185 0.32
186 0.31
187 0.3
188 0.33
189 0.34
190 0.32
191 0.3
192 0.23
193 0.21
194 0.2
195 0.18
196 0.15
197 0.12
198 0.09
199 0.08
200 0.08
201 0.07
202 0.07
203 0.06
204 0.05
205 0.04
206 0.04
207 0.04
208 0.05
209 0.06
210 0.07
211 0.08
212 0.09
213 0.09
214 0.08
215 0.09
216 0.09
217 0.1
218 0.11
219 0.12
220 0.12
221 0.12
222 0.12
223 0.12
224 0.12
225 0.12
226 0.11
227 0.11
228 0.12
229 0.13
230 0.13
231 0.13
232 0.13
233 0.13
234 0.11
235 0.1
236 0.09
237 0.08
238 0.09
239 0.08
240 0.07
241 0.06
242 0.06
243 0.06
244 0.06
245 0.07
246 0.06
247 0.06
248 0.07
249 0.07
250 0.07
251 0.07
252 0.08
253 0.08
254 0.1
255 0.1
256 0.11
257 0.17
258 0.19
259 0.24
260 0.23
261 0.23
262 0.23
263 0.27
264 0.25
265 0.2
266 0.2
267 0.19
268 0.22
269 0.26
270 0.27
271 0.29
272 0.32
273 0.39
274 0.48
275 0.55
276 0.61
277 0.64
278 0.72
279 0.71
280 0.78
281 0.79
282 0.79
283 0.79
284 0.81
285 0.78
286 0.69
287 0.68
288 0.63
289 0.6
290 0.58
291 0.54
292 0.49
293 0.51
294 0.57
295 0.58
296 0.54
297 0.58
298 0.56
299 0.54
300 0.52
301 0.48
302 0.43
303 0.42
304 0.4
305 0.31
306 0.25
307 0.21
308 0.18
309 0.14
310 0.12
311 0.07
312 0.07
313 0.07
314 0.08
315 0.08
316 0.08
317 0.15
318 0.17
319 0.19
320 0.25
321 0.32
322 0.41
323 0.5
324 0.59
325 0.63
326 0.7
327 0.78
328 0.82
329 0.85
330 0.84
331 0.84
332 0.83
333 0.79
334 0.72
335 0.69
336 0.61
337 0.52
338 0.48
339 0.47
340 0.45
341 0.41
342 0.45
343 0.48
344 0.54
345 0.56
346 0.59
347 0.58
348 0.56
349 0.58
350 0.58
351 0.52
352 0.5
353 0.48
354 0.44
355 0.43
356 0.4
357 0.36
358 0.3
359 0.3
360 0.25
361 0.25
362 0.29
363 0.28
364 0.27
365 0.27
366 0.28
367 0.27
368 0.28
369 0.32
370 0.27
371 0.25