Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6FVL2

Protein Details
Accession Q6FVL2    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
108-128GKTAFSRRKKVVKPEKFTNDTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, mito_nucl 11.666, cyto_nucl 11.333, mito 6.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006973  Cwf_Cwc_15  
Gene Ontology GO:0005634  C:nucleus  
GO:0005684  C:U2-type spliceosomal complex  
GO:0003723  F:RNA binding  
GO:0000398  P:mRNA splicing, via spliceosome  
KEGG cgr:CAGL0E01023g  -  
Pfam View protein in Pfam  
PF04889  Cwf_Cwc_15  
Amino Acid Sequences MTTAHRPQLEARNGAKGALVPTGTEHARLLPGHTELKARKPKNKTTSQIQTSSDAGSVDDSTSAGTNIGTGSATLGPSQVQKMIQPLEVEDKKDIKLVKKEDDSVSWGKTAFSRRKKVVKPEKFTNDTVRSQKHKEFLNRFVK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.38
3 0.3
4 0.25
5 0.21
6 0.19
7 0.11
8 0.13
9 0.17
10 0.16
11 0.16
12 0.14
13 0.13
14 0.15
15 0.15
16 0.16
17 0.14
18 0.17
19 0.18
20 0.19
21 0.24
22 0.24
23 0.33
24 0.41
25 0.44
26 0.49
27 0.55
28 0.64
29 0.67
30 0.74
31 0.71
32 0.7
33 0.75
34 0.72
35 0.69
36 0.61
37 0.54
38 0.45
39 0.4
40 0.31
41 0.21
42 0.16
43 0.12
44 0.1
45 0.07
46 0.06
47 0.06
48 0.05
49 0.05
50 0.05
51 0.04
52 0.04
53 0.04
54 0.04
55 0.04
56 0.04
57 0.03
58 0.04
59 0.04
60 0.05
61 0.04
62 0.05
63 0.05
64 0.06
65 0.07
66 0.07
67 0.07
68 0.08
69 0.1
70 0.12
71 0.13
72 0.12
73 0.13
74 0.2
75 0.21
76 0.22
77 0.22
78 0.22
79 0.21
80 0.24
81 0.26
82 0.23
83 0.3
84 0.33
85 0.38
86 0.39
87 0.43
88 0.41
89 0.41
90 0.4
91 0.35
92 0.32
93 0.25
94 0.22
95 0.19
96 0.21
97 0.28
98 0.33
99 0.39
100 0.46
101 0.53
102 0.63
103 0.69
104 0.77
105 0.79
106 0.8
107 0.79
108 0.81
109 0.84
110 0.79
111 0.76
112 0.74
113 0.69
114 0.66
115 0.66
116 0.64
117 0.61
118 0.62
119 0.64
120 0.61
121 0.63
122 0.66
123 0.66