Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6FME9

Protein Details
Accession Q6FME9    Localization Confidence High Confidence Score 16.3
NoLS Segment(s)
PositionSequenceProtein Nature
47-68VLKSKERKAEPIQKQQTPRKDSHydrophilic
306-350EEEQQKSEPLPVKKKKPKKYNLVSNNFRRLKLPKKNRNPRFGRRRHydrophilic
NLS Segment(s)
PositionSequence
317-350VKKKKPKKYNLVSNNFRRLKLPKKNRNPRFGRRR
Subcellular Location(s) nucl 25, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021110  DNA_rep_checkpnt_protein  
IPR040203  Sld2  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0031261  C:DNA replication preinitiation complex  
GO:0003688  F:DNA replication origin binding  
GO:0003697  F:single-stranded DNA binding  
GO:0006270  P:DNA replication initiation  
GO:0071163  P:DNA replication preinitiation complex assembly  
GO:0000727  P:double-strand break repair via break-induced replication  
GO:0033314  P:mitotic DNA replication checkpoint signaling  
GO:0031333  P:negative regulation of protein-containing complex assembly  
KEGG cgr:CAGL0K08602g  -  
Pfam View protein in Pfam  
PF11719  Drc1-Sld2  
CDD cd22289  RecQL4_SLD2_NTD  
Amino Acid Sequences MDMDVQQVKLKIKRWEHAFIAEHNRPPDKDDIRPLTEMKQLYKLYSVLKSKERKAEPIQKQQTPRKDSNMVLGPTPQIYGKAVSIFEMKVSPLKVEETPTTEVEEDIESEIESSVNRRNSDEASANEEKLGIHSVKKRLFESPKKTENTTHLAVPQVTRYGPNSPLKLAQTVSIRQHLLTPKKKKAEPKSLYTPSPLLKRNSSKTLYELAHEHLQYVEEIKELDQQFKSEIVPIRHGNGQDIGDESDEVPEKKKRRTGVLRRLQFDEDENDRTIKKDLHKELLKLKSRKVKEFLGKEDNEPSEEEEEEQQKSEPLPVKKKKPKKYNLVSNNFRRLKLPKKNRNPRFGRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.63
3 0.6
4 0.63
5 0.59
6 0.57
7 0.6
8 0.57
9 0.55
10 0.54
11 0.55
12 0.47
13 0.47
14 0.5
15 0.45
16 0.45
17 0.5
18 0.52
19 0.52
20 0.55
21 0.53
22 0.47
23 0.49
24 0.45
25 0.38
26 0.39
27 0.35
28 0.34
29 0.34
30 0.33
31 0.31
32 0.36
33 0.38
34 0.36
35 0.43
36 0.49
37 0.53
38 0.6
39 0.6
40 0.6
41 0.64
42 0.7
43 0.71
44 0.75
45 0.77
46 0.74
47 0.8
48 0.81
49 0.81
50 0.79
51 0.74
52 0.7
53 0.67
54 0.61
55 0.59
56 0.58
57 0.49
58 0.42
59 0.38
60 0.32
61 0.27
62 0.27
63 0.19
64 0.12
65 0.12
66 0.12
67 0.12
68 0.13
69 0.12
70 0.13
71 0.15
72 0.14
73 0.13
74 0.12
75 0.12
76 0.13
77 0.13
78 0.12
79 0.11
80 0.14
81 0.14
82 0.17
83 0.18
84 0.2
85 0.22
86 0.23
87 0.24
88 0.21
89 0.2
90 0.17
91 0.16
92 0.12
93 0.1
94 0.09
95 0.07
96 0.07
97 0.07
98 0.06
99 0.06
100 0.07
101 0.12
102 0.16
103 0.17
104 0.18
105 0.2
106 0.21
107 0.25
108 0.27
109 0.23
110 0.27
111 0.28
112 0.27
113 0.25
114 0.24
115 0.19
116 0.16
117 0.18
118 0.1
119 0.13
120 0.18
121 0.25
122 0.29
123 0.31
124 0.32
125 0.37
126 0.45
127 0.51
128 0.55
129 0.56
130 0.6
131 0.6
132 0.61
133 0.57
134 0.52
135 0.48
136 0.41
137 0.33
138 0.27
139 0.26
140 0.24
141 0.21
142 0.18
143 0.13
144 0.12
145 0.12
146 0.12
147 0.13
148 0.18
149 0.22
150 0.22
151 0.21
152 0.24
153 0.24
154 0.24
155 0.21
156 0.19
157 0.18
158 0.2
159 0.21
160 0.21
161 0.21
162 0.19
163 0.23
164 0.25
165 0.31
166 0.37
167 0.43
168 0.47
169 0.53
170 0.57
171 0.62
172 0.66
173 0.68
174 0.64
175 0.63
176 0.66
177 0.64
178 0.61
179 0.54
180 0.48
181 0.4
182 0.41
183 0.38
184 0.32
185 0.34
186 0.39
187 0.41
188 0.45
189 0.44
190 0.39
191 0.37
192 0.4
193 0.34
194 0.3
195 0.27
196 0.24
197 0.25
198 0.24
199 0.22
200 0.16
201 0.15
202 0.14
203 0.14
204 0.11
205 0.07
206 0.07
207 0.07
208 0.14
209 0.14
210 0.18
211 0.16
212 0.17
213 0.17
214 0.18
215 0.18
216 0.16
217 0.21
218 0.19
219 0.24
220 0.24
221 0.26
222 0.28
223 0.28
224 0.25
225 0.23
226 0.21
227 0.16
228 0.17
229 0.15
230 0.12
231 0.12
232 0.11
233 0.1
234 0.11
235 0.11
236 0.14
237 0.2
238 0.24
239 0.3
240 0.35
241 0.37
242 0.46
243 0.56
244 0.64
245 0.68
246 0.74
247 0.75
248 0.74
249 0.74
250 0.65
251 0.55
252 0.46
253 0.41
254 0.35
255 0.31
256 0.29
257 0.27
258 0.25
259 0.26
260 0.26
261 0.25
262 0.28
263 0.35
264 0.39
265 0.47
266 0.51
267 0.55
268 0.61
269 0.65
270 0.68
271 0.62
272 0.64
273 0.64
274 0.66
275 0.69
276 0.65
277 0.65
278 0.65
279 0.68
280 0.69
281 0.68
282 0.64
283 0.59
284 0.61
285 0.53
286 0.45
287 0.38
288 0.33
289 0.26
290 0.24
291 0.23
292 0.22
293 0.23
294 0.23
295 0.23
296 0.2
297 0.2
298 0.2
299 0.25
300 0.27
301 0.33
302 0.43
303 0.52
304 0.62
305 0.72
306 0.81
307 0.85
308 0.89
309 0.91
310 0.91
311 0.92
312 0.92
313 0.93
314 0.93
315 0.92
316 0.91
317 0.91
318 0.84
319 0.74
320 0.69
321 0.66
322 0.66
323 0.68
324 0.69
325 0.7
326 0.77
327 0.87
328 0.91
329 0.94
330 0.93