Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6FTN4

Protein Details
Accession Q6FTN4    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
90-112DAAERRERERLERRRRRKSRSDNBasic
NLS Segment(s)
PositionSequence
94-110RRERERLERRRRRKSRS
Subcellular Location(s) cyto 13.5, cyto_nucl 12.833, nucl 10, cyto_mito 9.166
Family & Domain DBs
KEGG cgr:CAGL0G01122g  -  
Amino Acid Sequences MQVLNDIYNGTLNTISITGYNSVKSVVIVSSWMLSPVKSLCYMIGGNGADETASNGSSNSSSSYQLKGGMPATVEPRSNHTVITRYDLIDAAERRERERLERRRRRKSRSDN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.08
4 0.09
5 0.11
6 0.11
7 0.12
8 0.11
9 0.12
10 0.12
11 0.11
12 0.1
13 0.08
14 0.07
15 0.07
16 0.07
17 0.08
18 0.07
19 0.09
20 0.08
21 0.08
22 0.09
23 0.09
24 0.1
25 0.1
26 0.1
27 0.09
28 0.11
29 0.11
30 0.1
31 0.13
32 0.11
33 0.1
34 0.1
35 0.1
36 0.07
37 0.07
38 0.08
39 0.04
40 0.04
41 0.04
42 0.04
43 0.05
44 0.05
45 0.06
46 0.07
47 0.08
48 0.1
49 0.11
50 0.13
51 0.13
52 0.15
53 0.15
54 0.15
55 0.14
56 0.13
57 0.12
58 0.12
59 0.15
60 0.15
61 0.17
62 0.16
63 0.21
64 0.24
65 0.24
66 0.23
67 0.21
68 0.24
69 0.23
70 0.29
71 0.25
72 0.22
73 0.22
74 0.22
75 0.21
76 0.23
77 0.22
78 0.21
79 0.25
80 0.25
81 0.27
82 0.32
83 0.33
84 0.36
85 0.46
86 0.52
87 0.58
88 0.69
89 0.77
90 0.83
91 0.91
92 0.92