Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2FHM2

Protein Details
Accession A0A0D2FHM2   
Localization Confidence Medium
Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
435-476DEPAEEKRGRRHWRRHPNMHHEGDRRRWRDKVTERERKRYEGBasic
NLS Segment(s)
PositionSequence
374-387SKKVPPPIPRRRSK
440-472EKRGRRHWRRHPNMHHEGDRRRWRDKVTERERK
Subcellular Location(s) mito 14, nucl 9, cyto_nucl 7, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR011992  EF-hand-dom_pair  
IPR000261  EH_dom  
PROSITE View protein in PROSITE  
PS50031  EH  
Amino Acid Sequences MSEKQARRPPVAPKPSFIQQHNAATTKLSPLPSPALRGATLAFGAPAVKPPNISISASHNPSAGALLAATTASIRKQQQQAQQNEAATSQESAFNARGRPLTTEKLPTAVSNNSSLSPPKPGLRPHAARSTSAVAAVAASAKTSPVRRPELRRDQGSSYLARREPSQVRSRGMSTSSSSETVQSLQQSAAALAGAKASMTTAPVPIQNATGDKQRSDLGYLLNLPLYSAQSSSAPSPSISGATAAATASRNAASLEARRRALSTSEESSPSAPVFRNLPASPQSTTGSSWPRLRVSPPQTDSESDTGRVKVEQAPKPLPAPVPVRANRAAIVAQEQAVAQDSRTGMTASSLADAMVAGSIAATHTGSRGASPASKKVPPPIPRRRSKSVGAFGSARQLMHLPGMRSETMSQTPKLKPLPMRPMRQTLRNNSPEHDEPAEEKRGRRHWRRHPNMHHEGDRRRWRDKVTERERKRYEGVWAANRGLLIDYDMDNPDLEGRKDGASPGDLVVNIVVRDIWERSRLPKDVLEEIWDLVAQPGAKTLNREEFVVGLWLIDQRLKGRKLPVKVSPSVWSSVRHPQGVKISSKALHK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.65
3 0.67
4 0.59
5 0.57
6 0.53
7 0.58
8 0.59
9 0.55
10 0.47
11 0.42
12 0.4
13 0.37
14 0.35
15 0.28
16 0.23
17 0.25
18 0.32
19 0.32
20 0.35
21 0.33
22 0.32
23 0.3
24 0.31
25 0.27
26 0.22
27 0.2
28 0.15
29 0.12
30 0.09
31 0.1
32 0.09
33 0.14
34 0.16
35 0.16
36 0.17
37 0.18
38 0.23
39 0.25
40 0.26
41 0.23
42 0.28
43 0.35
44 0.37
45 0.37
46 0.31
47 0.28
48 0.27
49 0.26
50 0.18
51 0.11
52 0.07
53 0.06
54 0.06
55 0.06
56 0.06
57 0.05
58 0.06
59 0.07
60 0.13
61 0.16
62 0.24
63 0.31
64 0.39
65 0.47
66 0.56
67 0.61
68 0.62
69 0.64
70 0.57
71 0.51
72 0.44
73 0.36
74 0.27
75 0.23
76 0.16
77 0.14
78 0.13
79 0.15
80 0.18
81 0.19
82 0.2
83 0.21
84 0.23
85 0.21
86 0.26
87 0.29
88 0.32
89 0.33
90 0.38
91 0.35
92 0.36
93 0.35
94 0.31
95 0.3
96 0.28
97 0.26
98 0.23
99 0.24
100 0.22
101 0.23
102 0.24
103 0.21
104 0.23
105 0.23
106 0.25
107 0.29
108 0.32
109 0.39
110 0.46
111 0.5
112 0.51
113 0.58
114 0.55
115 0.5
116 0.5
117 0.46
118 0.37
119 0.31
120 0.26
121 0.16
122 0.14
123 0.13
124 0.1
125 0.06
126 0.06
127 0.05
128 0.06
129 0.09
130 0.12
131 0.17
132 0.23
133 0.31
134 0.38
135 0.47
136 0.57
137 0.65
138 0.7
139 0.7
140 0.68
141 0.63
142 0.62
143 0.57
144 0.5
145 0.42
146 0.41
147 0.37
148 0.34
149 0.32
150 0.33
151 0.36
152 0.39
153 0.44
154 0.43
155 0.44
156 0.46
157 0.46
158 0.41
159 0.37
160 0.32
161 0.26
162 0.24
163 0.24
164 0.23
165 0.21
166 0.2
167 0.19
168 0.18
169 0.17
170 0.14
171 0.13
172 0.11
173 0.12
174 0.11
175 0.1
176 0.09
177 0.07
178 0.06
179 0.05
180 0.05
181 0.04
182 0.04
183 0.03
184 0.04
185 0.04
186 0.05
187 0.05
188 0.06
189 0.08
190 0.09
191 0.1
192 0.1
193 0.11
194 0.11
195 0.12
196 0.13
197 0.18
198 0.18
199 0.17
200 0.18
201 0.19
202 0.18
203 0.18
204 0.18
205 0.13
206 0.13
207 0.14
208 0.13
209 0.12
210 0.11
211 0.09
212 0.08
213 0.09
214 0.07
215 0.07
216 0.07
217 0.07
218 0.09
219 0.1
220 0.1
221 0.1
222 0.09
223 0.1
224 0.1
225 0.1
226 0.09
227 0.08
228 0.07
229 0.07
230 0.07
231 0.06
232 0.07
233 0.06
234 0.06
235 0.07
236 0.06
237 0.06
238 0.06
239 0.07
240 0.08
241 0.13
242 0.19
243 0.22
244 0.22
245 0.22
246 0.23
247 0.23
248 0.24
249 0.22
250 0.2
251 0.2
252 0.21
253 0.21
254 0.21
255 0.21
256 0.2
257 0.16
258 0.14
259 0.11
260 0.1
261 0.11
262 0.11
263 0.15
264 0.14
265 0.17
266 0.18
267 0.2
268 0.2
269 0.2
270 0.2
271 0.17
272 0.18
273 0.19
274 0.2
275 0.2
276 0.22
277 0.22
278 0.23
279 0.23
280 0.25
281 0.3
282 0.32
283 0.36
284 0.36
285 0.37
286 0.37
287 0.37
288 0.37
289 0.31
290 0.27
291 0.2
292 0.19
293 0.16
294 0.15
295 0.14
296 0.13
297 0.16
298 0.23
299 0.26
300 0.3
301 0.31
302 0.32
303 0.32
304 0.33
305 0.28
306 0.24
307 0.24
308 0.23
309 0.29
310 0.3
311 0.33
312 0.33
313 0.33
314 0.29
315 0.27
316 0.23
317 0.15
318 0.15
319 0.11
320 0.1
321 0.09
322 0.09
323 0.08
324 0.09
325 0.08
326 0.06
327 0.08
328 0.08
329 0.08
330 0.08
331 0.08
332 0.07
333 0.07
334 0.08
335 0.06
336 0.07
337 0.06
338 0.06
339 0.05
340 0.05
341 0.05
342 0.04
343 0.03
344 0.02
345 0.02
346 0.02
347 0.02
348 0.03
349 0.03
350 0.03
351 0.04
352 0.05
353 0.05
354 0.05
355 0.06
356 0.07
357 0.11
358 0.13
359 0.18
360 0.22
361 0.25
362 0.26
363 0.33
364 0.4
365 0.45
366 0.53
367 0.59
368 0.65
369 0.71
370 0.78
371 0.78
372 0.75
373 0.73
374 0.71
375 0.68
376 0.61
377 0.54
378 0.48
379 0.41
380 0.42
381 0.36
382 0.26
383 0.19
384 0.17
385 0.14
386 0.17
387 0.19
388 0.14
389 0.15
390 0.18
391 0.17
392 0.18
393 0.19
394 0.18
395 0.21
396 0.23
397 0.23
398 0.27
399 0.28
400 0.33
401 0.34
402 0.36
403 0.37
404 0.43
405 0.53
406 0.54
407 0.61
408 0.6
409 0.67
410 0.65
411 0.68
412 0.67
413 0.64
414 0.66
415 0.66
416 0.63
417 0.55
418 0.58
419 0.52
420 0.48
421 0.41
422 0.32
423 0.28
424 0.31
425 0.38
426 0.34
427 0.34
428 0.37
429 0.45
430 0.54
431 0.61
432 0.67
433 0.69
434 0.78
435 0.87
436 0.9
437 0.91
438 0.91
439 0.91
440 0.88
441 0.85
442 0.82
443 0.78
444 0.78
445 0.77
446 0.72
447 0.67
448 0.64
449 0.6
450 0.63
451 0.65
452 0.66
453 0.67
454 0.73
455 0.75
456 0.82
457 0.81
458 0.76
459 0.7
460 0.61
461 0.57
462 0.55
463 0.55
464 0.52
465 0.51
466 0.46
467 0.44
468 0.4
469 0.34
470 0.25
471 0.18
472 0.12
473 0.1
474 0.1
475 0.12
476 0.13
477 0.13
478 0.12
479 0.12
480 0.15
481 0.16
482 0.15
483 0.15
484 0.16
485 0.17
486 0.18
487 0.19
488 0.17
489 0.16
490 0.16
491 0.15
492 0.15
493 0.13
494 0.13
495 0.13
496 0.12
497 0.11
498 0.1
499 0.09
500 0.07
501 0.1
502 0.12
503 0.14
504 0.17
505 0.19
506 0.26
507 0.33
508 0.36
509 0.37
510 0.39
511 0.41
512 0.41
513 0.4
514 0.38
515 0.32
516 0.3
517 0.27
518 0.23
519 0.18
520 0.13
521 0.14
522 0.1
523 0.08
524 0.11
525 0.14
526 0.15
527 0.18
528 0.24
529 0.3
530 0.31
531 0.32
532 0.3
533 0.28
534 0.27
535 0.26
536 0.21
537 0.12
538 0.11
539 0.12
540 0.12
541 0.13
542 0.14
543 0.17
544 0.26
545 0.29
546 0.33
547 0.42
548 0.49
549 0.55
550 0.61
551 0.64
552 0.64
553 0.65
554 0.64
555 0.59
556 0.55
557 0.52
558 0.46
559 0.41
560 0.38
561 0.44
562 0.46
563 0.46
564 0.44
565 0.46
566 0.53
567 0.56
568 0.55
569 0.48
570 0.48