Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D2END1

Protein Details
Accession A0A0D2END1    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
66-86EGEPKERKKRGHGVRKPLVMLBasic
NLS Segment(s)
PositionSequence
70-81KERKKRGHGVRK
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MEEDDASLTSEDLAPLDDTQSGERAAVGGSFSSIQKLFSRSALSVRAAPPPQNQYPLSRAQGNILEGEPKERKKRGHGVRKPLVML
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.09
4 0.09
5 0.1
6 0.11
7 0.12
8 0.11
9 0.1
10 0.09
11 0.08
12 0.07
13 0.07
14 0.06
15 0.05
16 0.05
17 0.06
18 0.06
19 0.08
20 0.08
21 0.09
22 0.1
23 0.13
24 0.13
25 0.13
26 0.15
27 0.14
28 0.16
29 0.17
30 0.16
31 0.16
32 0.17
33 0.2
34 0.19
35 0.21
36 0.22
37 0.26
38 0.27
39 0.29
40 0.29
41 0.28
42 0.3
43 0.33
44 0.32
45 0.29
46 0.28
47 0.26
48 0.27
49 0.25
50 0.23
51 0.18
52 0.18
53 0.16
54 0.22
55 0.25
56 0.29
57 0.36
58 0.41
59 0.45
60 0.51
61 0.61
62 0.66
63 0.72
64 0.74
65 0.77
66 0.81