Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2GXJ1

Protein Details
Accession A0A0D2GXJ1   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
104-123KEAQEPPKPRPKPKIRPLSEBasic
NLS Segment(s)
PositionSequence
104-120KEAQEPPKPRPKPKIRP
293-295PKK
Subcellular Location(s) mito 13.5, cyto_mito 9.333, nucl 5.5, cyto_nucl 5.333, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR010754  OPA3-like  
Pfam View protein in Pfam  
PF07047  OPA3  
Amino Acid Sequences MSLTLKFTSLAVRTLSKPIANFIKKQAREHEGFRRTCISFAQTLHRIDMRWRIGLLQDAAALEKQVAKEQAAEAAKRHKHANIPTVKTEAQMKAEEEAAEKAAKEAQEPPKPRPKPKIRPLSEAKAIESGANFISEAFLFGVAAGLILFESWRSGRKETQRRDDVAERLNDLEESEKAARKALVELEREVLRLRAQEKNGKPTTTIRLLPKEIYEEDKDKEDDKAAQPLGYWSRLTSLMSFSKSDNEAKETLAKNEPGPAEKILVQSDKALEEKHRQKKALEEAEKMAAEQKPKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.33
3 0.3
4 0.29
5 0.32
6 0.4
7 0.4
8 0.42
9 0.46
10 0.53
11 0.54
12 0.59
13 0.61
14 0.58
15 0.58
16 0.62
17 0.63
18 0.61
19 0.59
20 0.57
21 0.55
22 0.48
23 0.45
24 0.41
25 0.35
26 0.3
27 0.31
28 0.35
29 0.35
30 0.35
31 0.37
32 0.36
33 0.33
34 0.32
35 0.39
36 0.34
37 0.3
38 0.29
39 0.27
40 0.26
41 0.3
42 0.27
43 0.19
44 0.16
45 0.15
46 0.15
47 0.14
48 0.13
49 0.09
50 0.1
51 0.09
52 0.12
53 0.13
54 0.13
55 0.14
56 0.14
57 0.2
58 0.21
59 0.21
60 0.2
61 0.28
62 0.31
63 0.32
64 0.34
65 0.3
66 0.35
67 0.4
68 0.47
69 0.47
70 0.49
71 0.49
72 0.51
73 0.48
74 0.42
75 0.41
76 0.34
77 0.28
78 0.25
79 0.23
80 0.2
81 0.2
82 0.19
83 0.16
84 0.14
85 0.12
86 0.11
87 0.1
88 0.09
89 0.1
90 0.1
91 0.1
92 0.17
93 0.24
94 0.32
95 0.35
96 0.4
97 0.49
98 0.54
99 0.6
100 0.63
101 0.65
102 0.68
103 0.75
104 0.81
105 0.75
106 0.78
107 0.78
108 0.74
109 0.7
110 0.6
111 0.51
112 0.41
113 0.37
114 0.29
115 0.22
116 0.16
117 0.09
118 0.08
119 0.07
120 0.05
121 0.06
122 0.05
123 0.06
124 0.05
125 0.04
126 0.04
127 0.04
128 0.04
129 0.03
130 0.03
131 0.02
132 0.02
133 0.02
134 0.02
135 0.02
136 0.02
137 0.03
138 0.03
139 0.07
140 0.1
141 0.12
142 0.18
143 0.28
144 0.38
145 0.45
146 0.54
147 0.56
148 0.56
149 0.59
150 0.58
151 0.52
152 0.47
153 0.41
154 0.32
155 0.27
156 0.25
157 0.2
158 0.16
159 0.13
160 0.08
161 0.11
162 0.12
163 0.13
164 0.13
165 0.15
166 0.15
167 0.14
168 0.15
169 0.17
170 0.2
171 0.2
172 0.21
173 0.23
174 0.23
175 0.23
176 0.21
177 0.17
178 0.13
179 0.14
180 0.16
181 0.19
182 0.23
183 0.31
184 0.35
185 0.44
186 0.46
187 0.44
188 0.43
189 0.42
190 0.44
191 0.4
192 0.41
193 0.37
194 0.39
195 0.41
196 0.4
197 0.37
198 0.34
199 0.3
200 0.3
201 0.29
202 0.27
203 0.26
204 0.28
205 0.29
206 0.26
207 0.26
208 0.23
209 0.24
210 0.23
211 0.28
212 0.25
213 0.24
214 0.23
215 0.27
216 0.28
217 0.25
218 0.23
219 0.16
220 0.18
221 0.19
222 0.2
223 0.16
224 0.18
225 0.2
226 0.22
227 0.23
228 0.21
229 0.24
230 0.26
231 0.29
232 0.26
233 0.26
234 0.25
235 0.25
236 0.32
237 0.3
238 0.31
239 0.33
240 0.32
241 0.29
242 0.34
243 0.34
244 0.29
245 0.3
246 0.27
247 0.25
248 0.25
249 0.27
250 0.26
251 0.26
252 0.24
253 0.23
254 0.23
255 0.23
256 0.22
257 0.22
258 0.23
259 0.31
260 0.41
261 0.49
262 0.55
263 0.55
264 0.56
265 0.63
266 0.69
267 0.69
268 0.65
269 0.6
270 0.56
271 0.58
272 0.56
273 0.47
274 0.42
275 0.34