Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2GX29

Protein Details
Accession A0A0D2GX29    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
6-30LKEARLKIVKREKKRSSSDKQYQQEHydrophilic
NLS Segment(s)
PositionSequence
12-20KIVKREKKR
Subcellular Location(s) nucl 11.5, cyto_nucl 9.5, mito 9, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MGDGLLKEARLKIVKREKKRSSSDKQYQQEMRKRPEDPAIAVYAGQTGVVGRPKPDPIYIGLRSSRVGSGPYPALGLTIIYLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.6
3 0.7
4 0.74
5 0.77
6 0.85
7 0.85
8 0.83
9 0.85
10 0.84
11 0.84
12 0.79
13 0.78
14 0.76
15 0.76
16 0.74
17 0.71
18 0.67
19 0.62
20 0.59
21 0.53
22 0.51
23 0.44
24 0.38
25 0.32
26 0.27
27 0.21
28 0.2
29 0.17
30 0.11
31 0.09
32 0.07
33 0.05
34 0.03
35 0.05
36 0.08
37 0.08
38 0.09
39 0.11
40 0.14
41 0.16
42 0.16
43 0.16
44 0.17
45 0.24
46 0.25
47 0.27
48 0.26
49 0.26
50 0.26
51 0.26
52 0.24
53 0.17
54 0.18
55 0.14
56 0.17
57 0.18
58 0.17
59 0.16
60 0.15
61 0.14
62 0.12
63 0.12