Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q6FQK1

Protein Details
Accession Q6FQK1    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
107-131MSSTVRGCRKHHHRRPSMALKFDKPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto_nucl 15.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR031426  DUF4667  
KEGG cgr:CAGL0I05610g  -  
Pfam View protein in Pfam  
PF15700  DUF4667  
Amino Acid Sequences MSEAMNDYYTPLNTPLEAHLVYHDDKAELNVRTPASSRQGSITSLSSSMCDTEAKDCSCSGCVSPLVQCESYTDTTSLSRTNSNINSNMNSNMNSNMNSNMNSMNSMSSTVRGCRKHHHRRPSMALKFDKPIVYK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.17
4 0.17
5 0.16
6 0.15
7 0.18
8 0.19
9 0.19
10 0.17
11 0.14
12 0.14
13 0.16
14 0.2
15 0.17
16 0.18
17 0.2
18 0.2
19 0.21
20 0.22
21 0.24
22 0.24
23 0.24
24 0.23
25 0.22
26 0.23
27 0.23
28 0.24
29 0.21
30 0.16
31 0.15
32 0.15
33 0.12
34 0.11
35 0.1
36 0.09
37 0.08
38 0.08
39 0.1
40 0.14
41 0.14
42 0.14
43 0.14
44 0.14
45 0.15
46 0.14
47 0.12
48 0.1
49 0.1
50 0.1
51 0.11
52 0.12
53 0.13
54 0.13
55 0.12
56 0.12
57 0.14
58 0.15
59 0.15
60 0.13
61 0.12
62 0.12
63 0.13
64 0.13
65 0.11
66 0.11
67 0.11
68 0.16
69 0.18
70 0.21
71 0.22
72 0.23
73 0.23
74 0.24
75 0.25
76 0.22
77 0.2
78 0.18
79 0.18
80 0.17
81 0.16
82 0.16
83 0.16
84 0.16
85 0.16
86 0.16
87 0.15
88 0.14
89 0.14
90 0.14
91 0.12
92 0.11
93 0.12
94 0.12
95 0.13
96 0.14
97 0.18
98 0.25
99 0.29
100 0.32
101 0.4
102 0.51
103 0.6
104 0.68
105 0.74
106 0.77
107 0.81
108 0.88
109 0.89
110 0.86
111 0.84
112 0.81
113 0.74
114 0.69
115 0.64