Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6FUP9

Protein Details
Accession Q6FUP9   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
75-95YLKYLTKKYLKKNQLRDWIRFHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 13, mito 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR002671  Ribosomal_L22e  
IPR038526  Ribosomal_L22e_sf  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0002181  P:cytoplasmic translation  
KEGG cgr:CAGL0F01683g  -  
Pfam View protein in Pfam  
PF01776  Ribosomal_L22e  
Amino Acid Sequences MAPNTARKQKVVKTFTVDVSAPTENGVFDPASYAKYLIDHIKVENVVGNLGNAITVEEDGSVVTIVSTTKFSGKYLKYLTKKYLKKNQLRDWIRFVSTKTNSYRLAFYQVTPEEEEEDEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.54
3 0.51
4 0.43
5 0.34
6 0.33
7 0.29
8 0.21
9 0.18
10 0.16
11 0.12
12 0.12
13 0.12
14 0.08
15 0.07
16 0.09
17 0.09
18 0.1
19 0.1
20 0.1
21 0.09
22 0.09
23 0.12
24 0.12
25 0.14
26 0.14
27 0.14
28 0.16
29 0.16
30 0.15
31 0.15
32 0.12
33 0.1
34 0.09
35 0.09
36 0.06
37 0.06
38 0.06
39 0.04
40 0.04
41 0.03
42 0.03
43 0.03
44 0.03
45 0.03
46 0.03
47 0.03
48 0.03
49 0.03
50 0.03
51 0.03
52 0.03
53 0.04
54 0.05
55 0.05
56 0.07
57 0.08
58 0.09
59 0.16
60 0.17
61 0.21
62 0.26
63 0.35
64 0.38
65 0.41
66 0.49
67 0.51
68 0.57
69 0.62
70 0.67
71 0.68
72 0.72
73 0.78
74 0.8
75 0.81
76 0.8
77 0.75
78 0.72
79 0.66
80 0.6
81 0.51
82 0.44
83 0.43
84 0.41
85 0.43
86 0.4
87 0.42
88 0.43
89 0.43
90 0.44
91 0.36
92 0.4
93 0.34
94 0.3
95 0.33
96 0.32
97 0.33
98 0.31
99 0.3
100 0.26