Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2GUW8

Protein Details
Accession A0A0D2GUW8   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
45-66TDTWLERNRKKQRRTRMIGCFIHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 19, mito 5, cyto 1, pero 1, golg 1, cyto_pero 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAAGVRDPAFWRRFSMAVHLDEEKGTISDTRSNSTASSTAPLRHTDTWLERNRKKQRRTRMIGCFIAISFILAIVGIVLVLLWWAKVGPFKDKSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.34
3 0.31
4 0.31
5 0.33
6 0.3
7 0.28
8 0.26
9 0.25
10 0.18
11 0.13
12 0.11
13 0.09
14 0.1
15 0.15
16 0.16
17 0.18
18 0.18
19 0.19
20 0.18
21 0.19
22 0.18
23 0.13
24 0.14
25 0.13
26 0.15
27 0.16
28 0.18
29 0.2
30 0.19
31 0.2
32 0.21
33 0.23
34 0.29
35 0.35
36 0.41
37 0.41
38 0.51
39 0.6
40 0.66
41 0.72
42 0.72
43 0.76
44 0.78
45 0.83
46 0.82
47 0.81
48 0.79
49 0.72
50 0.64
51 0.53
52 0.42
53 0.35
54 0.25
55 0.16
56 0.08
57 0.06
58 0.05
59 0.04
60 0.04
61 0.03
62 0.03
63 0.02
64 0.02
65 0.02
66 0.02
67 0.02
68 0.02
69 0.02
70 0.03
71 0.03
72 0.04
73 0.1
74 0.12
75 0.2