Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D2EN57

Protein Details
Accession A0A0D2EN57    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
60-79RIEEKQRRKRLSRLLSGGKRBasic
NLS Segment(s)
PositionSequence
64-79KQRRKRLSRLLSGGKR
Subcellular Location(s) nucl 24, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MPSKFTEILDPQYQTTSPQDDVRLEDIIGAANMSVRDRTSSEASSTSHSSSSASSSDSDRIEEKQRRKRLSRLLSGGKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.26
3 0.24
4 0.21
5 0.22
6 0.24
7 0.23
8 0.25
9 0.25
10 0.22
11 0.18
12 0.16
13 0.14
14 0.11
15 0.1
16 0.07
17 0.04
18 0.04
19 0.05
20 0.05
21 0.05
22 0.05
23 0.07
24 0.07
25 0.11
26 0.12
27 0.13
28 0.14
29 0.15
30 0.16
31 0.17
32 0.18
33 0.16
34 0.14
35 0.14
36 0.13
37 0.12
38 0.13
39 0.11
40 0.1
41 0.11
42 0.12
43 0.16
44 0.15
45 0.17
46 0.16
47 0.19
48 0.28
49 0.35
50 0.43
51 0.5
52 0.59
53 0.66
54 0.71
55 0.77
56 0.78
57 0.8
58 0.8
59 0.79